BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0708 (701 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U52077-1|AAC52010.1| 343|Homo sapiens mariner transposase protein. 41 0.005 U80776-1|AAC52012.1| 671|Homo sapiens unknown protein. 39 0.015 DQ341316-1|ABC72087.1| 344|Homo sapiens SETMAR protein. 39 0.015 BC008931-1|AAH08931.2| 429|Homo sapiens SETMAR protein protein. 39 0.015 AY952295-1|AAY29570.1| 671|Homo sapiens metnase protein. 39 0.015 AK222734-1|BAD96454.1| 671|Homo sapiens SET domain and mariner ... 39 0.015 AF054989-1|AAC09350.1| 671|Homo sapiens unknown protein. 39 0.015 BC051462-1|AAH51462.2| 458|Homo sapiens transmembrane protein 1... 30 9.2 AK025757-1|BAB15233.1| 354|Homo sapiens protein ( Homo sapiens ... 30 9.2 >U52077-1|AAC52010.1| 343|Homo sapiens mariner transposase protein. Length = 343 Score = 40.7 bits (91), Expect = 0.005 Identities = 25/65 (38%), Positives = 34/65 (52%) Frame = -1 Query: 488 PVLPLHDNVRPHTAQQTVSKLL*S*QAGSFASPPHSLTLLDLVLMEFNFFQSLHYFLVRK 309 P+L LHDN RPH AQ T+ KL + PH DL +++FF+ L FL K Sbjct: 242 PIL-LHDNARPHVAQPTLQKL----NELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGK 296 Query: 308 KINTQ 294 + + Q Sbjct: 297 RFHNQ 301 >U80776-1|AAC52012.1| 671|Homo sapiens unknown protein. Length = 671 Score = 39.1 bits (87), Expect = 0.015 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = -1 Query: 488 PVLPLHDNVRPHTAQQTVSKLL*S*QAGSFASPPHSLTLLDLVLMEFNFFQSLHYFLVRK 309 P+L LHDN RPH AQ T+ KL + PH DL+ ++ F+ L+ FL K Sbjct: 570 PIL-LHDNARPHVAQPTLQKL----NELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 624 Query: 308 KINTQ 294 + + Q Sbjct: 625 RFHNQ 629 >DQ341316-1|ABC72087.1| 344|Homo sapiens SETMAR protein. Length = 344 Score = 39.1 bits (87), Expect = 0.015 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = -1 Query: 488 PVLPLHDNVRPHTAQQTVSKLL*S*QAGSFASPPHSLTLLDLVLMEFNFFQSLHYFLVRK 309 P+L LHDN RPH AQ T+ KL + PH DL+ ++ F+ L+ FL K Sbjct: 243 PIL-LHDNARPHVAQPTLQKL----NELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 297 Query: 308 KINTQ 294 + + Q Sbjct: 298 RFHNQ 302 >BC008931-1|AAH08931.2| 429|Homo sapiens SETMAR protein protein. Length = 429 Score = 39.1 bits (87), Expect = 0.015 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = -1 Query: 488 PVLPLHDNVRPHTAQQTVSKLL*S*QAGSFASPPHSLTLLDLVLMEFNFFQSLHYFLVRK 309 P+L LHDN RPH AQ T+ KL + PH DL+ ++ F+ L+ FL K Sbjct: 328 PIL-LHDNARPHVAQPTLQKL----NELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 382 Query: 308 KINTQ 294 + + Q Sbjct: 383 RFHNQ 387 >AY952295-1|AAY29570.1| 671|Homo sapiens metnase protein. Length = 671 Score = 39.1 bits (87), Expect = 0.015 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = -1 Query: 488 PVLPLHDNVRPHTAQQTVSKLL*S*QAGSFASPPHSLTLLDLVLMEFNFFQSLHYFLVRK 309 P+L LHDN RPH AQ T+ KL + PH DL+ ++ F+ L+ FL K Sbjct: 570 PIL-LHDNARPHVAQPTLQKL----NELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 624 Query: 308 KINTQ 294 + + Q Sbjct: 625 RFHNQ 629 >AK222734-1|BAD96454.1| 671|Homo sapiens SET domain and mariner transposase fusion gene variant protein. Length = 671 Score = 39.1 bits (87), Expect = 0.015 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = -1 Query: 488 PVLPLHDNVRPHTAQQTVSKLL*S*QAGSFASPPHSLTLLDLVLMEFNFFQSLHYFLVRK 309 P+L LHDN RPH AQ T+ KL + PH DL+ ++ F+ L+ FL K Sbjct: 570 PIL-LHDNARPHVAQPTLQKL----NELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 624 Query: 308 KINTQ 294 + + Q Sbjct: 625 RFHNQ 629 >AF054989-1|AAC09350.1| 671|Homo sapiens unknown protein. Length = 671 Score = 39.1 bits (87), Expect = 0.015 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = -1 Query: 488 PVLPLHDNVRPHTAQQTVSKLL*S*QAGSFASPPHSLTLLDLVLMEFNFFQSLHYFLVRK 309 P+L LHDN RPH AQ T+ KL + PH DL+ ++ F+ L+ FL K Sbjct: 570 PIL-LHDNARPHVAQPTLQKL----NELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 624 Query: 308 KINTQ 294 + + Q Sbjct: 625 RFHNQ 629 >BC051462-1|AAH51462.2| 458|Homo sapiens transmembrane protein 135 protein. Length = 458 Score = 29.9 bits (64), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -3 Query: 402 FCVTTALLDFVRSCADGVQFFPKFAL--LLGKEE 307 FC+T A+ F C DG++ F AL ++GKEE Sbjct: 158 FCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEE 191 >AK025757-1|BAB15233.1| 354|Homo sapiens protein ( Homo sapiens cDNA: FLJ22104 fis, clone HEP17633. ). Length = 354 Score = 29.9 bits (64), Expect = 9.2 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -3 Query: 402 FCVTTALLDFVRSCADGVQFFPKFAL--LLGKEE 307 FC+T A+ F C DG++ F AL ++GKEE Sbjct: 54 FCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEE 87 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,903,206 Number of Sequences: 237096 Number of extensions: 2102381 Number of successful extensions: 3619 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3618 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8119219030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -