BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0706 (702 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0316 + 3479574-3482679,3482766-3483127 29 2.7 10_08_0731 + 20161962-20163628,20163721-20163862,20164181-201644... 29 4.7 04_04_0671 - 27157692-27158620,27158711-27158828,27158967-271591... 29 4.7 >10_01_0316 + 3479574-3482679,3482766-3483127 Length = 1155 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 446 FQQDSAPAHRAKSTQDWLAARKSTSSGTKTGPPP 547 F PA + W +R S+SSG T PPP Sbjct: 45 FLDSLPPASQRLLLPSWRQSRSSSSSGNATAPPP 78 >10_08_0731 + 20161962-20163628,20163721-20163862,20164181-20164490, 20164566-20166466,20166557-20166650,20166953-20167440, 20167919-20168599,20168870-20168944,20170148-20170210, 20170588-20170633,20171373-20171420,20171484-20171557 Length = 1862 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/51 (23%), Positives = 26/51 (50%) Frame = +3 Query: 519 HPARRLALLQSRFESVRLQDMGNTLRKKACSKPHPNLESLKTSLIKAAADI 671 H R L L+ + +VRL +G T+++K C ++ ++ L+ ++ Sbjct: 1353 HCVRLLLLVSTDLLAVRLSGIGRTVKEKVCVHTSRDIRAIARQLVSVWVEV 1403 >04_04_0671 - 27157692-27158620,27158711-27158828,27158967-27159156, 27159281-27159415,27159537-27159634,27160034-27160206, 27160299-27160772,27161464-27161518 Length = 723 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 238 KKRATVSACPTRSFSILAHGMVGSFLLGLNRGTF 339 ++ + C ++I G GSFLLGLN+ T+ Sbjct: 158 QENTVIQTCAVACYTIGYGGGFGSFLLGLNKKTY 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,543,394 Number of Sequences: 37544 Number of extensions: 440900 Number of successful extensions: 1054 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1054 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -