Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0705
         (662 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g31400.1 68414.m03845 meprin and TRAF homology domain-contain...    29   2.8  

>At1g31400.1 68414.m03845 meprin and TRAF homology domain-containing
           protein / MATH domain-containing protein low similarity
           to ubiquitin-specific protease 12 [Arabidopsis thaliana]
           GI:11993471; contains Pfam profile PF00917: MATH domain
          Length = 278

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/43 (34%), Positives = 25/43 (58%)
 Frame = -3

Query: 426 SSWKCLCVYFQVFLSG*RQYNEIKF*KSDGKVCNKHISLFLYV 298
           SS +   +YF +F+ G  +++ + + K  G   NK +SLFL V
Sbjct: 17  SSLQSHAIYFDIFVVGDTKWHLLAYPKGYGDSINKCLSLFLGV 59


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,278,073
Number of Sequences: 28952
Number of extensions: 249762
Number of successful extensions: 422
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 415
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 422
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1393347168
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)