BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0704 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_38574| Best HMM Match : WW (HMM E-Value=4.9) 34 0.097 SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_39284| Best HMM Match : WW (HMM E-Value=7.9) 34 0.13 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 33 0.17 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 33 0.17 SB_5514| Best HMM Match : TB (HMM E-Value=4.3) 33 0.22 SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_54439| Best HMM Match : SNF (HMM E-Value=0) 33 0.22 SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) 33 0.22 SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) 33 0.22 SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 33 0.30 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 32 0.39 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) 32 0.52 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 32 0.52 SB_35235| Best HMM Match : zf-CCCH (HMM E-Value=8) 31 0.68 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_54846| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28356| Best HMM Match : AAA_5 (HMM E-Value=0) 30 1.6 SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 30 1.6 SB_36564| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 29 2.8 SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_1670| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 29 3.6 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 29 3.6 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 29 3.6 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.8 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 29 4.8 SB_26710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 29 4.8 SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 29 4.8 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 29 4.8 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.8 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 29 4.8 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.8 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.8 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.8 SB_48962| Best HMM Match : Cadherin (HMM E-Value=0) 28 6.4 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 28 6.4 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 28 6.4 SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) 28 6.4 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 28 6.4 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 28 8.4 SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) 28 8.4 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 28 8.4 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 28 8.4 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 28 8.4 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 28 8.4 SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_29909| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=1.8) 28 8.4 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 28 8.4 SB_23115| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 28 8.4 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) 28 8.4 SB_5348| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 34.7 bits (76), Expect = 0.073 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS V A+ D L+++Q R ++A Sbjct: 62 ITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 34.7 bits (76), Expect = 0.073 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS V A+ D L+++Q R ++A Sbjct: 62 ITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_38574| Best HMM Match : WW (HMM E-Value=4.9) Length = 256 Score = 34.3 bits (75), Expect = 0.097 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS+ A+ D L+++Q R ++A Sbjct: 132 ITVYRSPIRSVIEYASIAFANLQNYLSDVLENVQRRVLKIA 172 >SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAV-GAPWFVR 284 +T+Y++ IR V+ YAS A+ D L+++Q R ++A G + VR Sbjct: 99 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAFPGRSYVVR 148 >SB_39284| Best HMM Match : WW (HMM E-Value=7.9) Length = 251 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 127 ITVYRSLIRSVIEYASAAFANLPNYLFDALENVQRRALKIA 167 >SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) Length = 754 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVGA 299 +T+Y++ IR V+ YAS A+ D L+++Q R ++A A Sbjct: 575 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAFPA 618 >SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) Length = 596 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVGA 299 +T+Y++ IR V+ YAS A+ D L+++Q R ++A A Sbjct: 444 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAFPA 487 >SB_5514| Best HMM Match : TB (HMM E-Value=4.3) Length = 243 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 62 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 102 >SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 213 ITVYRSLIRSVIEYASATFANLPNYLSDALENVQRRTLKIA 253 >SB_54439| Best HMM Match : SNF (HMM E-Value=0) Length = 701 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 658 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 698 >SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 199 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 239 >SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) Length = 397 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 273 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 313 >SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) Length = 587 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 84 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 124 >SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+ +Q R ++A Sbjct: 59 ITVYRSLIRSVIEYASAAFANLPNYLSDALEDVQRRALKIA 99 >SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 179 ITVYRSFIRSVIEYASAAFANLPNCLCDDLENVQRRALKIA 219 >SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) Length = 595 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+++Q R ++A Sbjct: 480 ITVYRSLIRSVIEYASAAFANFPNYLSDALENVQRRALKIA 520 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = -1 Query: 421 YKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFCR 314 YKT +RP + YAS V + ID ++++Q +RFC+ Sbjct: 516 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 554 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = -1 Query: 421 YKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFCR 314 YKT +RP + YAS V + ID ++++Q +RFC+ Sbjct: 98 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 136 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = -1 Query: 421 YKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFCR 314 YKT +RP + YAS V + ID ++++Q +RFC+ Sbjct: 584 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 622 >SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) Length = 208 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ D L+ +Q R ++A Sbjct: 84 ITVYRSLIRSVIEYASEAFANLPNYLSDALEKVQRRALKIA 124 >SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) Length = 479 Score = 31.9 bits (69), Expect = 0.52 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ Y+S A+ D L+++Q R ++A Sbjct: 382 ITVYRSLIRSVIEYSSAAFANLPNYLSDALENVQRRALKIA 422 >SB_35235| Best HMM Match : zf-CCCH (HMM E-Value=8) Length = 119 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 701 NPSKK*LRCYFRGEAPHGFPP-GLGGGISHPGLL 603 +P K+ + C F G +P G PP G+ G SH G++ Sbjct: 28 SPCKRDVNCPFHGASPRGMPPSGILGLPSHHGMI 61 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLA 308 +T+Y++ IR V+ YAS A+ + L+++Q R ++A Sbjct: 981 ITVYRSLIRSVIEYASAAFANLPNYLSNALENVQRRALKIA 1021 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSR 323 + + VT+Y + IRP+ YASV+ ++ + L+ +Q R Sbjct: 4163 VEDMVTVYCSLIRPITEYASVIFSNIPCYLSEALEKIQRR 4202 >SB_54846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 569 VKYLGVTLDASMTFRPHIKSAVT 501 VKYLGV +D ++TF+ HI+ T Sbjct: 93 VKYLGVLIDKNLTFKYHIEHITT 115 >SB_28356| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 1737 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 368 RXPXXHRHPPISTIPLLQVGRW 303 R P +RHP I+ IPLLQ R+ Sbjct: 1247 RHPRYYRHPAITDIPLLQTSRY 1268 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 353 HRHPPISTIPLLQVGRW 303 +RHPPI+ IPLLQ R+ Sbjct: 1337 YRHPPITDIPLLQTSRY 1353 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 368 RXPXXHRHPPISTIPLLQVGRW 303 R P +RHP I+ IPLL+ R+ Sbjct: 1417 RTPSYYRHPAITDIPLLRTSRY 1438 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -3 Query: 422 LQNLHKARHDLRECGDCSRXPXXHRHPPISTIPLLQVGRW 303 LQ H RH + +RHP I+ IPLLQ R+ Sbjct: 1450 LQTSHYYRHSAITDIPLLQTSRYYRHPAITDIPLLQTSRY 1489 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -3 Query: 422 LQNLHKARHDLRECGDCSRXPXXHRHPPISTIPLLQVGRW 303 LQ H RH L + +RHP I+ IPLLQ + Sbjct: 1280 LQTSHYYRHPLITDTLILQTSHYYRHPTITDIPLLQTSHY 1319 >SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 436 NKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 +++T Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 118 HRITDYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 162 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 569 VKYLGVTLDASMTFRPHIKSAVT 501 VKYLGV +D ++TF+ HI+ T Sbjct: 257 VKYLGVLIDKNLTFKYHIEHITT 279 >SB_36564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 353 HRHPPISTIPLLQVGRW 303 +RHPPI+ IPLLQ R+ Sbjct: 96 YRHPPITDIPLLQTSRY 112 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 362 PXXHRHPPISTIPLLQVGRW 303 P +RHP I+ IPLLQ R+ Sbjct: 178 PRYYRHPAITDIPLLQTSRY 197 >SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) Length = 816 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = -3 Query: 569 VKYLGVTLDASMTFRPHIKSAV 504 +K LGVTLD+S+T++ HI + + Sbjct: 675 LKILGVTLDSSLTYKEHITTVL 696 >SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = -3 Query: 569 VKYLGVTLDASMTFRPHIKSAV 504 +K LGVTLD+S+T++ HI + + Sbjct: 287 LKILGVTLDSSLTYKEHITTVL 308 >SB_1670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXIDTLQSL 332 +T+Y++ IR V+ YAS A+ S D L+++ Sbjct: 99 ITVYRSLIRSVIEYASAAFANLSNYLSDALENV 131 >SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) Length = 679 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -1 Query: 436 NKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRL 311 N + +Y + +RPV+ YAS V + ++ ++S+Q + R+ Sbjct: 553 NLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 594 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 118 RVKVTAYTAIVRPMLEYASAAWDPHLKKDIASLEKVQRKAARFC 161 >SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) Length = 310 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -1 Query: 436 NKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRL 311 N + +Y + +RPV+ YAS V + ++ ++S+Q + R+ Sbjct: 184 NLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 225 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 909 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 952 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 14 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 57 >SB_26710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/22 (45%), Positives = 19/22 (86%) Frame = -3 Query: 569 VKYLGVTLDASMTFRPHIKSAV 504 +K LGVT+D+S++++ HI +A+ Sbjct: 131 LKILGVTMDSSLSYKRHISTAL 152 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 215 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 258 >SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGAPWFVRNVDLHD 266 L+ + Y I+P+ +YA V AS + + +LQ R RL + A +V L + Sbjct: 93 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPLFN 152 Query: 265 DL 260 L Sbjct: 153 KL 154 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 201 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 244 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 447 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 490 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 631 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 674 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 733 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 776 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAV 305 +++ VT+Y + IR + YASV+ + + L+ +Q R ++ + Sbjct: 2761 VKDMVTVYCSLIRSITEYASVIFPNIPCYLSEALEKIQRRALKIII 2806 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 421 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 464 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 664 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 707 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 623 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 666 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 506 RVKVTAYTAIVRPMLEYASAAWDPYLQKDIASLEKVQRKAARFC 549 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 439 RNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQ---SRFC 317 R KVT Y +RP++ YAS + I +L+ +Q +RFC Sbjct: 439 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 482 >SB_48962| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2225 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/63 (25%), Positives = 26/63 (41%) Frame = -3 Query: 608 LLSLDNPYPGPRKVKYLGVTLDASMTFRPHIKSAVTVPRLFSIDSTPGSVSRVKCPSEQG 429 +L DN +P + V + S T P++ L+ + G + RVK + G Sbjct: 1452 VLVADNGHPPQSTEVSITVKIAESKTHPPNVHPLTVYVNLYGSNLNGGVIGRVKATDKDG 1511 Query: 428 DTL 420 D L Sbjct: 1512 DLL 1514 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGA 299 L+ + Y I+P+ +YA V AS + + +LQ R RL + A Sbjct: 420 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNA 468 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRL 311 + + VT+Y + IR V YASV+ ++ + L+ +Q R ++ Sbjct: 787 VEDMVTVYCSLIRSVTEYASVIFSNIPCYLSEVLEKIQRRALKI 830 >SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGA 299 L+ + Y I+P+ +YA V AS + + +LQ R RL + A Sbjct: 95 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNA 143 >SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGAPWFVRNVDLHD 266 ++ + Y I+P+ +YA V AS + + +LQ R RL + A +V L + Sbjct: 214 IKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEHRAPSVPLFN 273 Query: 265 DL 260 L Sbjct: 274 RL 275 >SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGA 299 L+ + Y I+P+ +YA V AS + + +LQ R RL + A Sbjct: 203 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNA 251 >SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) Length = 238 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGA 299 L+ + Y I+P+ +YA V AS + + +LQ R RL + A Sbjct: 155 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNA 203 >SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1415 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGA 299 L+ + Y I+P+ +YA V AS + + +LQ R RL + A Sbjct: 214 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNA 262 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/42 (26%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 430 VTLYKTCIRPVMTYASVVIAHASRXXI-DTLQSLQSRFCRLA 308 + Y TC+RP++ Y + + H + + L+ +Q R +A Sbjct: 638 IGFYNTCVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIA 679 >SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGA 299 L+ + Y I+P+ +YA V AS + + +LQ R RL + A Sbjct: 130 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNA 178 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGA 299 L+ + Y I+P+ +YA V AS + + +LQ R RL + A Sbjct: 717 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNA 765 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 755 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 798 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) Length = 449 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 159 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 202 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 35 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 78 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 121 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 164 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 1462 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 1505 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 173 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 216 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 446 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 489 >SB_29909| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=1.8) Length = 441 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 152 NPDHAGASHSRRPRXVLTDPSDPITFALDAFSSNTRSRLRDP 27 NP G S RRPR +TDP+ + + S+ SR+ P Sbjct: 189 NPSRTGYSQKRRPR-TITDPTYILRVIESSDSTLPESRVNSP 229 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_23115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 599 LDNPYPGPRKVKYLGVTLDASMTFRPHIKSAVT 501 +D PY GPR K+L +T + T R I S +T Sbjct: 20 IDRPYYGPRTNKHLFITAE---TIRKRITSCIT 49 >SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHAS-RXXIDTLQSLQSRFCRLAVGA 299 L+ + Y I+P+ +YA V AS + + +LQ R RL + A Sbjct: 90 LKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLTRFLTLQKRAARLILNA 138 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 674 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 717 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 442 LRNKVTLYKTCIRPVMTYASVVIAHA-SRXXIDTLQSLQSRFCRL 311 ++ + Y TCIRPV YA V H + + L+ Q R R+ Sbjct: 1219 VKELLLFYLTCIRPVTEYACPVFHHCLPQYLSNDLERCQKRALRI 1263 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 436 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 479 >SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) Length = 244 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -1 Query: 433 KVTLYKTCIRPVMTYASVVIAHASRXXIDTLQSLQSRFCRLAVG 302 K Y + IRPVM YAS V + I+ L+ +Q R G Sbjct: 141 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 184 >SB_5348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 96 IRKDVSRASTVTGSCVIRIRGVVSGGNDKA 185 +R S+ S + G+ V I ++ GGNDKA Sbjct: 63 VRAHASKNSLILGNAVTHIIQMIVGGNDKA 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,596,332 Number of Sequences: 59808 Number of extensions: 421772 Number of successful extensions: 1319 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 1196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1317 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -