BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0703 (623 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.05 |||thiamine transporter |Schizosaccharomyces pombe|c... 27 2.2 SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 26 5.1 >SPBC1683.05 |||thiamine transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 559 Score = 27.1 bits (57), Expect = 2.2 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 461 LINQIATAVACFVKLHLFLITTSSKFIW 544 LI I+T +ACF L L S +W Sbjct: 225 LIKSISTYIACFAMLIFLLCNVGSHVVW 252 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 25.8 bits (54), Expect = 5.1 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 377 LFILTYKITFQLKK*NIQIINFAKGSICAQLYQFRND*FDYIKF 246 + +L YK+T + +I I A I A LY+F F++ KF Sbjct: 116 VLVLNYKVTLLVTVFSIVIPFGAGAGISAGLYKFTTREFEFGKF 159 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,458,962 Number of Sequences: 5004 Number of extensions: 51083 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -