BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= prgv0703
(623 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BX640833-1|CAE45907.1| 371|Homo sapiens hypothetical protein pr... 30 5.8
>BX640833-1|CAE45907.1| 371|Homo sapiens hypothetical protein
protein.
Length = 371
Score = 30.3 bits (65), Expect = 5.8
Identities = 14/52 (26%), Positives = 28/52 (53%)
Frame = +2
Query: 410 NMHECYRKL*NIDTARKLINQIATAVACFVKLHLFLITTSSKFIWMKCQLYI 565
N C L NI + +N++ A+ CF+KLH ++ S++ ++ +Y+
Sbjct: 320 NDSSCTEALYNIGLTYEKLNRLDEALDCFLKLHA-ILRNSAEVLYQIANMYL 370
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,335,827
Number of Sequences: 237096
Number of extensions: 1568284
Number of successful extensions: 1739
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1704
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1739
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6747805200
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -