BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0700 (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0285 - 14604499-14604608,14604692-14605203,14605339-146054... 28 8.3 >01_03_0285 - 14604499-14604608,14604692-14605203,14605339-14605418, 14605597-14605699,14605759-14605907,14606088-14606180, 14606289-14606675,14607690-14608124,14608198-14608311, 14608405-14608453,14608684-14608843,14608941-14609499 Length = 916 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = -3 Query: 701 PPCLHTVNWIKQPVQIQSRTRISHGPAIITFNITMSFEHIIDIGLSVNM 555 P C +T+ WI+ S+T++ A++ FN ++F +I G++V + Sbjct: 410 PVCRNTITWIR------SKTQVG---AVVPFNDNINFHKVIAAGVAVGV 449 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,767,044 Number of Sequences: 37544 Number of extensions: 235820 Number of successful extensions: 352 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -