BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0700 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 24 4.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 9.4 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 24.2 bits (50), Expect = 4.1 Identities = 8/18 (44%), Positives = 13/18 (72%), Gaps = 2/18 (11%) Frame = -3 Query: 701 PPCLHTVNWI--KQPVQI 654 PPC +V WI K+P+++ Sbjct: 203 PPCSESVTWILFKEPIEV 220 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 7.1 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -2 Query: 201 RLF*TKDKMYFIFHLSILGIKKEKRCNMNFLSGRFSKKRTASN 73 RLF D + H++ +++ KR NF S RT + Sbjct: 3191 RLFEYVDSWLLLAHVAPAAVREVKRIVQNFFGWGSSSSRTTKD 3233 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 9.4 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 177 MYFIFHLSILGIKKEKRCNMNFLSGRFSKKRT 82 +YFI + ILG + LSG FSK+RT Sbjct: 358 VYFI-SMVILGAFFVMNLILGVLSGEFSKERT 388 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 634,371 Number of Sequences: 2352 Number of extensions: 10677 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -