BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0700 (706 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81112-1|CAB03272.2| 673|Caenorhabditis elegans Hypothetical pr... 29 3.2 AF106575-11|AAC78166.1| 329|Caenorhabditis elegans Hypothetical... 28 5.7 >Z81112-1|CAB03272.2| 673|Caenorhabditis elegans Hypothetical protein T02B5.1 protein. Length = 673 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 408 YLLYSTSKTFSKNYGMNYEMNKMIIKLNRQIAFYQPVL 521 Y+LY +TFSK Y + L+ ++ FY P + Sbjct: 373 YVLYEEPETFSKKCQKQYMNGNSSMNLSNEMEFYTPAI 410 >AF106575-11|AAC78166.1| 329|Caenorhabditis elegans Hypothetical protein K04F1.7 protein. Length = 329 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +3 Query: 519 LLLFIKIINTNKHIDAQSNINNMFETHCDIKCN 617 +L+F II+ Q++I+ F++HC+ +CN Sbjct: 18 VLIFFNIISLTA---TQADISEFFDSHCESRCN 47 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,070,778 Number of Sequences: 27780 Number of extensions: 257579 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -