BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0700 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 24 1.6 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 24 1.6 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 24 1.6 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 693 FAYSKLDKTTGS-DSITHPDISWPGDYYI*YH 601 + +SK DK + T +I+ P DYY YH Sbjct: 148 YEFSKYDKLKKKLEEWTGKNITTPWDYYYIYH 179 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 693 FAYSKLDKTTGS-DSITHPDISWPGDYYI*YH 601 + +SK DK + T +I+ P DYY YH Sbjct: 163 YEFSKYDKLKKKLEEWTGKNITTPWDYYYIYH 194 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 693 FAYSKLDKTTGS-DSITHPDISWPGDYYI*YH 601 + +SK DK + T +I+ P DYY YH Sbjct: 51 YEFSKYDKLKKKLEEWTGKNITTPWDYYYIYH 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,806 Number of Sequences: 438 Number of extensions: 3265 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -