BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0698 (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.2 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 6.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 8.2 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 373 TMCVAVSHSVCQILIC 420 T+CVA+S S L+C Sbjct: 739 TLCVAISLSATVTLVC 754 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 624 FFDGFFWKLLRCR 586 +FDGF W+ LR R Sbjct: 625 WFDGFNWEGLRAR 637 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 373 TMCVAVSHSVCQILIC 420 T+CVA+S S L+C Sbjct: 829 TLCVAISLSATVTLVC 844 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +2 Query: 572 SVLDFRQRSNFQKKPSKKSHHDDEAMFRLN 661 S+L + + K+ SK +HH ++ +LN Sbjct: 47 SLLTSQPHQDHNKEKSKNNHHCNQDTEKLN 76 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,405 Number of Sequences: 438 Number of extensions: 2883 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -