BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0696 (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.5 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 6.2 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 8.2 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 128 LNLRKDLSASVSACRSARE 72 LNLR D+S+S S+ S+ E Sbjct: 365 LNLRTDISSSSSSISSSEE 383 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/65 (18%), Positives = 29/65 (44%) Frame = +1 Query: 112 SFRKFRLIAEYVQGRNVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVRQPMDTFYVSSA 291 SFR R+ A GRN + G K+ +++ +++ ++ + ++ S Sbjct: 410 SFRISRVAAYNTYGRNAGLRYRGPKQNKPKVLHAIRRGASILRVSMPKIKDVNIIDKYSR 469 Query: 292 LVSPI 306 ++ P+ Sbjct: 470 IIFPV 474 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 8.2 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 472 AFSMSLAMES-GINLFTTSLSSELVTSRVM 386 A S+S E G +L T+LSS LV SRV+ Sbjct: 599 ASSVSAGEEGLGNSLAITALSSILVLSRVI 628 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,960 Number of Sequences: 438 Number of extensions: 3790 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -