Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0695
         (697 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1 ...    22   4.2  
AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.        21   7.3  
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    21   9.6  

>AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1
           protein protein.
          Length = 371

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +1

Query: 637 HPYRSVPFPNI 669
           HP  SVPFP +
Sbjct: 105 HPLESVPFPQV 115


>AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.
          Length = 556

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 153 FRPLPHSFVGK 185
           FRP PH+ VG+
Sbjct: 127 FRPHPHNLVGR 137


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 2/47 (4%)
 Frame = -3

Query: 620 HDCVREIED--VVLGK*ERQ*MNAEHLIFFSKQQESICRSDGAQTQC 486
           +DCV +        G  E Q M    ++ F   ++SI   DG   QC
Sbjct: 579 YDCVAKNSQGYSARGSLEVQVMVPPQILPFDFGEDSINEGDGVSVQC 625


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 158,868
Number of Sequences: 336
Number of extensions: 3305
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18322480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)