BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= prgv0695
(697 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 8.5
AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 8.5
AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 8.5
>Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein
RJP57-1 protein.
Length = 544
Score = 21.4 bits (43), Expect = 8.5
Identities = 11/33 (33%), Positives = 16/33 (48%)
Frame = -3
Query: 479 ERENVYI*VTYNKTK*TIMFL*SDQPFHWTTLN 381
+R N + + K + IM+ SD FH T N
Sbjct: 200 DRTNTMVYIADEKGEGLIMYQNSDDSFHRLTSN 232
>AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice
variant B protein.
Length = 810
Score = 21.4 bits (43), Expect = 8.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = +3
Query: 153 FRPLPHSFVGK 185
+RP PH+ VGK
Sbjct: 109 YRPHPHNLVGK 119
>AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein.
Length = 602
Score = 21.4 bits (43), Expect = 8.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = +3
Query: 153 FRPLPHSFVGK 185
+RP PH+ VGK
Sbjct: 109 YRPHPHNLVGK 119
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,041
Number of Sequences: 438
Number of extensions: 3501
Number of successful extensions: 8
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21317625
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -