SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0695
         (697 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    21   8.5  
AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    21   8.5  
AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     21   8.5  

>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 11/33 (33%), Positives = 16/33 (48%)
 Frame = -3

Query: 479 ERENVYI*VTYNKTK*TIMFL*SDQPFHWTTLN 381
           +R N  + +   K +  IM+  SD  FH  T N
Sbjct: 200 DRTNTMVYIADEKGEGLIMYQNSDDSFHRLTSN 232


>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 153 FRPLPHSFVGK 185
           +RP PH+ VGK
Sbjct: 109 YRPHPHNLVGK 119


>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 153 FRPLPHSFVGK 185
           +RP PH+ VGK
Sbjct: 109 YRPHPHNLVGK 119


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,041
Number of Sequences: 438
Number of extensions: 3501
Number of successful extensions: 8
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21317625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -