BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0694 (702 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0878 + 12088119-12088233,12088511-12088608,12088689-120887... 31 1.2 06_03_1219 - 28491185-28494415 28 8.3 >03_02_0878 + 12088119-12088233,12088511-12088608,12088689-12088795, 12088900-12088974,12089053-12089124,12089221-12089382, 12089476-12089550,12089635-12089706,12089813-12089884, 12090150-12090224,12090329-12090400,12090491-12090625, 12090712-12091187,12091270-12091779,12091876-12092111, 12092200-12092712 Length = 954 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 Query: 379 NCGLFSKNTTALWAGCTRQRNCPTKLDLKTKLAFVTLVRNQQS 507 N G + TT + AGC+ N P +L KL+++ L NQ S Sbjct: 122 NIGNLKQLTTLILAGCSFHGNIPDELGSLPKLSYMALNSNQFS 164 >06_03_1219 - 28491185-28494415 Length = 1076 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 453 FRGTIPLACASCP 415 FRGTIP C SCP Sbjct: 189 FRGTIPSLCVSCP 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,973,423 Number of Sequences: 37544 Number of extensions: 258188 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -