BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0692 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0027 - 250837-250877,250972-252909,253733-253805,254476-25... 28 7.8 >03_01_0027 - 250837-250877,250972-252909,253733-253805,254476-254555, 255336-255595,255721-255785,256747-256839 Length = 849 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 536 VPLLPKKPLAMDLK*KLMIFLQEKKNAGKPR 628 + ++P+ LAM L+ +L +QE+K +GK R Sbjct: 30 IQMVPRSILAMTLRCRLSSRIQERKQSGKGR 60 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,901,549 Number of Sequences: 37544 Number of extensions: 267130 Number of successful extensions: 495 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -