BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0692 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_24193| Best HMM Match : Acetyltransf_1 (HMM E-Value=5.8e-08) 28 7.9 SB_23246| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.3e-09) 28 7.9 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -1 Query: 124 LISNESNELRCEIGRVKKIFLKFVSIAITKYLFKVSNKPR 5 L S+ N LRC+IG +K IF+ +S+ + +F V K R Sbjct: 6697 LNSSRLNTLRCQIGGLKLIFVDEISM-VGNTMFNVQFKNR 6735 >SB_24193| Best HMM Match : Acetyltransf_1 (HMM E-Value=5.8e-08) Length = 281 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 79 PDQFHILVHWIRLKSKSKWQCKFQTTFIIL 168 PD+ ++L H IRL + KW+ T +IL Sbjct: 9 PDENNLLSHVIRLIDREKWRMSSNTCELIL 38 >SB_23246| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.3e-09) Length = 305 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 79 PDQFHILVHWIRLKSKSKWQCKFQTTFIIL 168 PD+ ++L H IRL + KW+ T +IL Sbjct: 9 PDENNLLSHVIRLIDREKWRMSSNTCELIL 38 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,237,115 Number of Sequences: 59808 Number of extensions: 332274 Number of successful extensions: 501 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -