BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0691 (637 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0520 - 6852701-6855028,6855050-6855835,6856085-6856093 29 4.1 08_01_0074 + 530207-532603 27 9.4 >04_01_0520 - 6852701-6855028,6855050-6855835,6856085-6856093 Length = 1040 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 278 VACMNLNSLWGNVKRIIERFINVIYFHGVHFDKWMSKI 165 V N L GN I+ FI++++ VH D WM+ I Sbjct: 760 VEIRNRKQLQGN-DNILGNFIDIVHSLNVHDDSWMTSI 796 >08_01_0074 + 530207-532603 Length = 798 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 429 CLLHDYCSAGKLK 391 CLLH YCS+GK K Sbjct: 246 CLLHGYCSSGKPK 258 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,082,468 Number of Sequences: 37544 Number of extensions: 301539 Number of successful extensions: 661 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -