Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0691
         (637 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0520 - 6852701-6855028,6855050-6855835,6856085-6856093           29   4.1  
08_01_0074 + 530207-532603                                             27   9.4  

>04_01_0520 - 6852701-6855028,6855050-6855835,6856085-6856093
          Length = 1040

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = -3

Query: 278 VACMNLNSLWGNVKRIIERFINVIYFHGVHFDKWMSKI 165
           V   N   L GN   I+  FI++++   VH D WM+ I
Sbjct: 760 VEIRNRKQLQGN-DNILGNFIDIVHSLNVHDDSWMTSI 796


>08_01_0074 + 530207-532603
          Length = 798

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = -2

Query: 429 CLLHDYCSAGKLK 391
           CLLH YCS+GK K
Sbjct: 246 CLLHGYCSSGKPK 258


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,082,468
Number of Sequences: 37544
Number of extensions: 301539
Number of successful extensions: 661
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 638
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 661
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1561213104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)