BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0690 (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 140 6e-34 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 140 1e-33 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 86 2e-17 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 83 2e-16 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 83 2e-16 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 74 8e-14 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 62 4e-10 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 58 6e-09 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 57 1e-08 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 57 1e-08 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 56 2e-08 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 56 2e-08 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 48 5e-06 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 47 1e-05 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 45 6e-05 SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 42 4e-04 SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17) 41 0.001 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 36 0.020 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 33 0.14 SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 32 0.33 SB_21584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 30 1.7 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 29 4.0 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 29 4.0 SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_55750| Best HMM Match : PWWP (HMM E-Value=6.4e-07) 28 7.0 SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) 28 7.0 SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 27 9.3 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 140 bits (340), Expect = 6e-34 Identities = 69/97 (71%), Positives = 82/97 (84%), Gaps = 6/97 (6%) Frame = +2 Query: 236 TRNXALLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRE------CQALILAPTRELAQ 397 T+N +L RDVIAQAQSGTGKTATF+ISILQ+IDT+ ++ CQAL+LAPTRELAQ Sbjct: 114 TKNHYVLSARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQ 173 Query: 398 QIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGV 508 QIQKVV+ALGD+++ KCHACIGGTNVRED +LE GV Sbjct: 174 QIQKVVLALGDYMHVKCHACIGGTNVREDRMKLEEGV 210 Score = 85.4 bits (202), Expect = 3e-17 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +3 Query: 117 GTLDTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIXPCSKD 263 G ++WD+VVE+FDDMNLKE LLRGIYAYGFEKPSAIQQRAI PC ++ Sbjct: 52 GKRQSNWDEVVESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQE 100 Score = 62.5 bits (145), Expect = 3e-10 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 499 EWCYVVVGTPGRVYDMITRRALHANTIKLFVLDEADEMLSR 621 E +VVVGTPGRV+DMI R L+ IKLFVLDEADEMLSR Sbjct: 208 EGVHVVVGTPGRVFDMINRGVLNTRDIKLFVLDEADEMLSR 248 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 140 bits (338), Expect = 1e-33 Identities = 64/85 (75%), Positives = 78/85 (91%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD 430 +L+GRDVIAQAQSGTGKTATFSIS+LQ IDT +RE QAL+L+PTRELA QIQKVV+ALGD Sbjct: 31 ILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGD 90 Query: 431 HLNAKCHACIGGTNVREDIRQLESG 505 +++ +CHACIGGTN+ EDIR+L+ G Sbjct: 91 YMSVQCHACIGGTNIGEDIRKLDYG 115 Score = 55.2 bits (127), Expect = 4e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 508 YVVVGTPGRVYDMITRRALHANTIKLFVLDEADEMLSR 621 ++V GTPGRV+DMI RR L +IK+ VLDEADEML++ Sbjct: 117 HIVSGTPGRVFDMIRRRNLRTRSIKMLVLDEADEMLNK 154 Score = 33.1 bits (72), Expect = 0.19 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 207 GFEKPSAIQQRAIXPCSK 260 GFEKPSAIQQRAI P K Sbjct: 16 GFEKPSAIQQRAIKPILK 33 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 86.2 bits (204), Expect = 2e-17 Identities = 37/53 (69%), Positives = 48/53 (90%) Frame = +2 Query: 347 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESG 505 +RE QAL+L+PTRELA QIQKVV+ALGD+++ +CHACIGGTN+ EDIR+L+ G Sbjct: 1 LREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLDYG 53 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 82.6 bits (195), Expect = 2e-16 Identities = 37/81 (45%), Positives = 58/81 (71%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH 433 L GRD++A+A++GTGKTA + + +L++ DT+ QAL+L PTRELA Q ++ I LG H Sbjct: 82 LAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKH 141 Query: 434 LNAKCHACIGGTNVREDIRQL 496 + A+ GGT++++DI +L Sbjct: 142 MGAQVMVTTGGTSLKDDILRL 162 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/37 (40%), Positives = 27/37 (72%) Frame = +1 Query: 508 YVVVGTPGRVYDMITRRALHANTIKLFVLDEADEMLS 618 +V+V TPGRV D++ ++ + ++ V+DEAD++LS Sbjct: 174 HVIVATPGRVLDLMKKKLADMSKCQMLVMDEADKLLS 210 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F+D LK ELL GI+ GF+KPS IQ+ +I Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESI 78 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 82.6 bits (195), Expect = 2e-16 Identities = 37/81 (45%), Positives = 58/81 (71%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH 433 L GRD++A+A++GTGKTA + + +L++ DT+ QAL+L PTRELA Q ++ I LG H Sbjct: 82 LAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKH 141 Query: 434 LNAKCHACIGGTNVREDIRQL 496 + A+ GGT++++DI +L Sbjct: 142 MGAQVMVTTGGTSLKDDILRL 162 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/37 (40%), Positives = 27/37 (72%) Frame = +1 Query: 508 YVVVGTPGRVYDMITRRALHANTIKLFVLDEADEMLS 618 +V+V TPGRV D++ ++ + ++ V+DEAD++LS Sbjct: 174 HVIVATPGRVLDLMKKKLADMSKCQMLVMDEADKLLS 210 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F+D LK ELL GI+ GF+KPS IQ+ +I Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESI 78 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 74.1 bits (174), Expect = 8e-14 Identities = 37/82 (45%), Positives = 53/82 (64%), Gaps = 1/82 (1%) Frame = +2 Query: 260 GRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLN 439 G D+IAQA+SGTGKT FS+ L+ + T Q +IL PTRE+A Q++ V+ A+G H + Sbjct: 50 GLDLIAQAKSGTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYD 109 Query: 440 A-KCHACIGGTNVREDIRQLES 502 C IGG ++ ED + L+S Sbjct: 110 GLACKVFIGGISLEEDKKALKS 131 Score = 46.0 bits (104), Expect = 2e-05 Identities = 17/37 (45%), Positives = 29/37 (78%) Frame = +1 Query: 505 CYVVVGTPGRVYDMITRRALHANTIKLFVLDEADEML 615 C++ VGTPGRV +I ++ L ++++F+LDEAD++L Sbjct: 132 CHIAVGTPGRVKYLIEQKYLKTESVRMFILDEADKLL 168 Score = 32.7 bits (71), Expect = 0.25 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F + L LLRG+ GFEKPS IQ +AI Sbjct: 15 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAI 44 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 62.9 bits (146), Expect = 2e-10 Identities = 32/77 (41%), Positives = 49/77 (63%), Gaps = 2/77 (2%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIAL 424 ++ G+DV+A A++G+GKTA F I + +++ T + +ALIL+PTRELA Q QK + L Sbjct: 315 VMDGKDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKEL 374 Query: 425 GDHLNAKCHACIGGTNV 475 G K +GG +V Sbjct: 375 GRFTGLKSSVILGGDSV 391 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 514 VVGTPGRVYDMITRRALHANTIKLFVLDEAD 606 VV TPGR ++ L ++++ V DEAD Sbjct: 391 VVATPGRFLHVVMEMELKLSSVEYVVFDEAD 421 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/71 (43%), Positives = 45/71 (63%) Frame = +2 Query: 263 RDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA 442 +DVI A++G+GKT F++ ILQ + + + ALIL PTRELA QI + ALG + Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGV 61 Query: 443 KCHACIGGTNV 475 KC +GG ++ Sbjct: 62 KCAVIVGGIDM 72 Score = 33.1 bits (72), Expect = 0.19 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +1 Query: 508 YVVVGTPGRVYDMITR-RALHANTIKLFVLDEADEMLS 618 ++++ TPGR+ D + + T+K V+DEAD +L+ Sbjct: 84 HIIIATPGRLIDHLENTKGFSLRTLKYLVMDEADRILN 121 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 61.7 bits (143), Expect = 5e-10 Identities = 36/90 (40%), Positives = 50/90 (55%), Gaps = 5/90 (5%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISIL-----QQIDTSIRECQALILAPTRELAQQIQKVV 415 ++ GRD++A AQ+G+GKTA + + +L Q ++ R AL +APTRELA+QI Sbjct: 513 VMAGRDLMACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEA 572 Query: 416 IALGDHLNAKCHACIGGTNVREDIRQLESG 505 DH K C GG +V QLE G Sbjct: 573 RKFSDHTPIKVCVCYGGVSVPYQASQLERG 602 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/37 (45%), Positives = 27/37 (72%) Frame = +1 Query: 505 CYVVVGTPGRVYDMITRRALHANTIKLFVLDEADEML 615 C+ +VGTPGR+ D ++R ++ +I+ +LDEAD ML Sbjct: 603 CHFLVGTPGRLQDFVSREKIYLGSIQHLILDEADRML 639 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 58.0 bits (134), Expect = 6e-09 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 1/82 (1%) Frame = +2 Query: 260 GRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL- 436 G D+I QA+SG GKTA F ++ LQQ++ + L++ TRELA QI K ++ Sbjct: 84 GMDIICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMS 143 Query: 437 NAKCHACIGGTNVREDIRQLES 502 N K GG N+++D + L++ Sbjct: 144 NIKIAVFFGGINIKKDQQTLKT 165 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 508 YVVVGTPGRVYDMITRRALHANTIKLFVLDEADEMLSR 621 ++VVGTPGR+ + + L+ K F+LDE D+ML + Sbjct: 169 HIVVGTPGRILALTREKTLNLKHAKHFILDECDKMLEQ 206 Score = 32.3 bits (70), Expect = 0.33 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F D LK ELLR I GFE PS +Q I Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECI 78 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 58.0 bits (134), Expect = 6e-09 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 1/82 (1%) Frame = +2 Query: 260 GRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL- 436 G D+I QA+SG GKTA F ++ LQQ++ + L++ TRELA QI K ++ Sbjct: 84 GMDIICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMS 143 Query: 437 NAKCHACIGGTNVREDIRQLES 502 N K GG N+++D + L++ Sbjct: 144 NIKIAVFFGGINIKKDQQTLKT 165 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 508 YVVVGTPGRVYDMITRRALHANTIKLFVLDEADEMLSR 621 ++VVGTPGR+ + + L+ K F+LDE D+ML + Sbjct: 169 HIVVGTPGRILALTREKTLNLKHAKHFILDECDKMLEQ 206 Score = 32.3 bits (70), Expect = 0.33 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F D LK ELLR I GFE PS +Q I Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECI 78 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 57.2 bits (132), Expect = 1e-08 Identities = 32/82 (39%), Positives = 47/82 (57%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD 430 +LQGRD I A++G+GKTA F++ ILQ++ A++L PTRELA QI LG Sbjct: 41 ILQGRDCIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIADQFKVLGR 100 Query: 431 HLNAKCHACIGGTNVREDIRQL 496 + K +GG ++ + L Sbjct: 101 PIGLKEAVIVGGLDMMKQALSL 122 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 508 YVVVGTPGRVYDMI-TRRALHANTIKLFVLDEADEML 615 +VV+ TPGR+ D I + L+ I+ VLDEAD +L Sbjct: 127 HVVIATPGRLADHIKSTDTLNLKKIQFLVLDEADRLL 163 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 56.8 bits (131), Expect = 1e-08 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = +2 Query: 266 DVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH 433 ++IAQ+QSGTGKTA F +++L ++D + Q + L+PT ELA+Q KV A+G H Sbjct: 144 NMIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKH 199 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = +1 Query: 490 PTGEWC--YVVVGTPGRVYDMITR-RALHANTIKLFVLDEADEMLS 618 P G+ C ++++GTPG + D I + + + +FVLDEAD M++ Sbjct: 215 PRGQKCTDHIIIGTPGTLLDWIRKSKCFEPRKVSVFVLDEADIMIA 260 Score = 35.5 bits (78), Expect = 0.035 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 150 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 ++F+++ L L RG+Y GF KPS IQ+ A+ Sbjct: 103 KSFEELPLSANLRRGVYDMGFNKPSKIQETAL 134 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 56.8 bits (131), Expect = 1e-08 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 9/94 (9%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQI------DTSIREC---QALILAPTRELAQQI 403 ++ GRDV+A AQ+G+GKTA F + ++ + +S E QA+ +APTRELA QI Sbjct: 745 VIAGRDVMACAQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQI 804 Query: 404 QKVVIALGDHLNAKCHACIGGTNVREDIRQLESG 505 + C GG +V +RQL+SG Sbjct: 805 YLEARKFAHGTMLRPVVCYGGVSVSHQLRQLQSG 838 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 505 CYVVVGTPGRVYDMITRRALHANTIKLFVLDEADEML 615 C ++VGTPGR+ D I + + ++ +LDEAD ML Sbjct: 839 CNLLVGTPGRLTDFIEKGKVSLKGLQFLILDEADRML 875 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 56.4 bits (130), Expect = 2e-08 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 9/82 (10%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQI---------DTSIRECQALILAPTRELAQQIQ 406 LQ RD+I A++G+GKTA F+I +L I + + + ALILAPTRELAQQI+ Sbjct: 136 LQNRDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIE 195 Query: 407 KVVIALGDHLNAKCHACIGGTN 472 + ++ G L + + IGG + Sbjct: 196 EEILKFGRPLGIRTVSVIGGAD 217 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 56.0 bits (129), Expect = 2e-08 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 4/85 (4%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQ----QIDTSIRECQALILAPTRELAQQIQKVVIA 421 L GRDV+ A++G+GKT F I I++ Q TS+ AL+++PTRELA Q +V++ Sbjct: 85 LSGRDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVK 144 Query: 422 LGDHLNAKCHACIGGTNVREDIRQL 496 +G+ + IGG +++ + +++ Sbjct: 145 IGNKHDLSAGLIIGGKDLKNEQKRI 169 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 52.4 bits (120), Expect = 3e-07 Identities = 34/89 (38%), Positives = 45/89 (50%), Gaps = 5/89 (5%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFS----ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVI 418 L GRD+I A++G+GKTA F + I+ Q + + + LI APTREL QQI Sbjct: 552 LSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEAR 611 Query: 419 ALGDHLNAKCHACIGGTNVREDIRQLESG 505 G N A GG N E + L+ G Sbjct: 612 RFGKAYNIHVVAVFGGGNKYEQSKALQEG 640 Score = 34.7 bits (76), Expect = 0.061 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 499 EWCYVVVGTPGRVYDMITRRALHANTIKLFVLDEADEM 612 E +VV TPGR+ D + +A + + + V DEAD M Sbjct: 639 EGAEIVVATPGRLIDHVKAKATNLHRVTYLVFDEADRM 676 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 50.0 bits (114), Expect = 2e-06 Identities = 29/90 (32%), Positives = 50/90 (55%), Gaps = 4/90 (4%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQ---QIDTSIRE-CQALILAPTRELAQQIQKVVI 418 LL+GRD++ A++G+GKT F + +++ ++ R +I++PTREL+ Q V Sbjct: 606 LLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVAR 665 Query: 419 ALGDHLNAKCHACIGGTNVREDIRQLESGV 508 L H N +GG N + + +L+ GV Sbjct: 666 DLLKHHNFTYGIIMGGVNRKAEAERLQKGV 695 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 48.4 bits (110), Expect = 5e-06 Identities = 30/92 (32%), Positives = 50/92 (54%), Gaps = 6/92 (6%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQI-DTSI-----RECQALILAPTRELAQQIQKV 412 + G DVI QA++GTGKT +F++ +++++ D + R + L++APTRELA+Q+ Sbjct: 107 IYDGEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVGNE 166 Query: 413 VIALGDHLNAKCHACIGGTNVREDIRQLESGV 508 L +L C GG + SG+ Sbjct: 167 FENLKSNLEVYC--IYGGMPYEPQENAINSGL 196 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = +1 Query: 511 VVVGTPGRVYDMITRRALHANTIKLFVLDEADEML 615 V+VGTPGR+ D + + L + +K VLDE D ML Sbjct: 198 VLVGTPGRILDFMRQGTLDLSKLKHVVLDEVDRML 232 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 47.6 bits (108), Expect = 8e-06 Identities = 36/103 (34%), Positives = 52/103 (50%), Gaps = 19/103 (18%) Frame = +2 Query: 248 ALLQGRDVIAQAQSGTGKTATFSISILQQIDT--------------SIRECQ-----ALI 370 ALL RD+I A++G+GKT F I I+Q I+ S E Q ALI Sbjct: 164 ALLYHRDIIGAAETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALI 223 Query: 371 LAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 499 +APTRELA Q++ ++ + + K A +GG + R L+ Sbjct: 224 MAPTRELALQVKDHLVKAAKYTSVKVAAIVGGMAAPKQQRLLK 266 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/48 (45%), Positives = 29/48 (60%) Frame = +2 Query: 365 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGV 508 L+L PTRELAQQ+Q+V ++G H + GG IR+LE GV Sbjct: 136 LVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGV 183 Score = 34.7 bits (76), Expect = 0.061 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 511 VVVGTPGRVYDMITRRALHANTIKLFVLDEADEML 615 + + TPGR+ DM+ R + VLDEAD ML Sbjct: 185 ICIATPGRLIDMLESRKTNLRRCTYLVLDEADRML 219 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 3/52 (5%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQI---DTSIRECQALILAPTRELAQQ 400 L G+DV A A +GTGKTA F + IL+++ T + L++ PTRELA Q Sbjct: 45 LMGKDVCACAATGTGKTAAFMLPILERLLYRPTQSPAIRVLVITPTRELAIQ 96 >SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = +2 Query: 434 LNAKCHACIGGTNVREDIRQLESGV 508 ++ KCHACIGGTNVRED +LE GV Sbjct: 1 MHVKCHACIGGTNVREDRMKLEEGV 25 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +1 Query: 499 EWCYVVVGTPGRVYDMITRRAL 564 E +VVVGTPGRV+DMI R L Sbjct: 23 EGVHVVVGTPGRVFDMINRGVL 44 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +1 Query: 505 CYVVVGTPGRVYDMITRRALHANTIKLFVLDEADEML 615 C+++V TPGR+ DM+ R + ++I+ VLDEAD ML Sbjct: 976 CHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRML 1012 Score = 32.7 bits (71), Expect = 0.25 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +2 Query: 263 RDVIAQAQSGTGKTATFSISILQQI 337 RD++A AQ+G+GKTA F I IL +I Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRI 937 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +3 Query: 156 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 F+D++L E LL + G++KP+ +Q+ AI Sbjct: 877 FEDVDLGEILLHNVGLAGYKKPTPVQKYAI 906 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 5/56 (8%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ-----ALILAPTRELAQQI 403 ++ GRD+I A++G+GKT +S+ + + T ALIL PTREL QQ+ Sbjct: 106 VMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 132 DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI 245 D + +E+F D+NL EL + F+ P+ IQ +++ Sbjct: 66 DCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSL 103 >SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17) Length = 635 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/37 (43%), Positives = 26/37 (70%) Frame = +1 Query: 511 VVVGTPGRVYDMITRRALHANTIKLFVLDEADEMLSR 621 +V GTPG++ D IT + + +K F+LDEAD +L++ Sbjct: 138 IVTGTPGKLNDFITTDKISLHQVKFFILDEADGLLAQ 174 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +2 Query: 350 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESG 505 R+ A+++ PTRELA QI + N +C GGT + E I +L+ G Sbjct: 143 RDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRG 194 Score = 31.1 bits (67), Expect = 0.75 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +1 Query: 511 VVVGTPGRVYDMITR---RALHANTIKLFVLDEADEM 612 ++V TPGR+ DM+T R + VLDEAD M Sbjct: 197 IIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRM 233 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 36.3 bits (80), Expect = 0.020 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 9/95 (9%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKTATFSISILQQIDTS---------IRECQALILAPTRELAQQI 403 ++ VI AQ+G+GKT + ++ ++ ++ +A I+ P RELA QI Sbjct: 412 IIHRHHVICAAQTGSGKTLAYLAPLVHRLREDEERHGILARLKRPRACIVVPARELATQI 471 Query: 404 QKVVIALGDHLNAKCHACIGGTNVREDIRQLESGV 508 K +L H + IGG + LES V Sbjct: 472 LKTAKSLCHHARFRSVGLIGGRKQKWMRDDLESPV 506 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +1 Query: 511 VVVGTPGRVYDMITRRALHANTIKLFVLDEADEML 615 V+V TPGR+ ++I+R+A+ + V+DE D ML Sbjct: 258 VIVATPGRMVEIISRQAVDLTHVIGCVVDEVDTML 292 >SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 32.7 bits (71), Expect = 0.25 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = +3 Query: 27 ERRSEDWPEDSKNGPSKDQGSYD---GPPGMDPGTLDTDWDQVVETFDDMNLKEELLRGI 197 E+ +E+ E +K + D+G GPPG GT D VVE DD K E G Sbjct: 19 EKTAEEMRELAKKAEACDRGVRAILLGPPGSGKGTQLVSDDLVVELIDDNLTKPECQNGW 78 Query: 198 YAYGFEKPSA 227 GF + A Sbjct: 79 LLDGFPRTVA 88 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 32.3 bits (70), Expect = 0.33 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +2 Query: 263 RDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELA-QQIQKVVIALGD 430 + ++ ++++GTGK+ F +L + R +I+ PTRELA Q + +V LGD Sbjct: 198 KSLLIKSETGTGKSLVF---LLPSVQDPGRGYGTIIVVPTRELASQMLYEVSRLLGD 251 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 511 VVVGTPGRVYDMITRRALHANTIKLFVLDEADEML 615 +V+GTP R+++++ K V+DE D+ L Sbjct: 280 IVIGTPKRLWEIVQEHEHLFQRTKRIVIDEVDKTL 314 >SB_21584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1750 Score = 31.5 bits (68), Expect = 0.57 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 2/92 (2%) Frame = -2 Query: 351 RMLVSICCRIDIEKVAVFPVPDWA*AITSRPWSKAXLRVAGLQKVFQNHR-RICLSTILL 175 R+ VS+ C ++ + FP+PD + RPW K +R L VF + + + Sbjct: 652 RLNVSLSCP-ELSVMLRFPIPDLRPVVERRPWWKQAVRDESLLLVFSAFKFNTVVCSADP 710 Query: 174 *GSCHRRFRQLDP-SRCQVSQGPFPEVHRNYL 82 S RF+Q+D + P P +H + L Sbjct: 711 AASYELRFQQMDGYYKESAGATPIPVMHSSPL 742 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 248 ALLQGRDVIAQAQSGTGKTATFSISILQQIDTS 346 +LL+GRDV A G+GK + + I+ QI S Sbjct: 220 SLLRGRDVAGVAIEGSGKRLAYLLPIIHQITES 252 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 66 GPSKDQG-SYDGPPGMDPGTLDTDWDQVVETFDDMNLKEELLRG 194 GP +QG S GPPG PG T W+ + N E LRG Sbjct: 3363 GPKGEQGRSISGPPG-PPGAPGTSWNDSIVNGGLSNSLLESLRG 3405 >SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +2 Query: 332 QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 460 Q D++++E IL ELA++IQK++ LN K AC+ Sbjct: 58 QGDSTLKEPVQKILIIGLELAKEIQKLIDEASSGLNIKHAACL 100 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 562 LHANTIKLFVLDEADEMLSR 621 L +IK+ VLDEADEML++ Sbjct: 31 LDTRSIKMLVLDEADEMLNK 50 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 9 NMSYSSERRSEDWPEDSKNGPSKDQGSYDGP 101 +M Y SER P D P+ D GS D P Sbjct: 1171 SMEYDSERHPYQAPADEMVNPNTDGGSRDNP 1201 >SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 448 AFSIQVITKSYHHLLNLLGQLSCGSQDQSLTFTNACID 335 A ++Q +TK+Y HL+N+ G +++ T C D Sbjct: 201 AHALQTLTKAYRHLMNVTGN---RDKEEKANATEQCAD 235 >SB_55750| Best HMM Match : PWWP (HMM E-Value=6.4e-07) Length = 532 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 254 LQGRDVIAQAQSGTGKTATFSISILQQIDTSIRE 355 + G DV+A + SGT K + F ++++ D+ R+ Sbjct: 245 VNGSDVVANSSSGTVKRSLFLPEVMEENDSVFRD 278 >SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 51 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEE 182 +D N + D G+ D D GT+D D D V+ DD N + Sbjct: 71 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDNFDND 111 >SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 51 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEE 182 +D N + D G+ D D GT+D D D V+ DD N + Sbjct: 54 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDNFDND 94 >SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) Length = 829 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -3 Query: 203 GVYASQQFFFEVHVIEGFDNLIPVGVKC 120 GVY F H + GF N IP +C Sbjct: 742 GVYLESNVFQNGHALVGFQNTIPASQEC 769 >SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = +2 Query: 428 DHLNAKCHACIG-GTNVRED-IRQLESGVM 511 D++N++C C+G G ++ ++ RQL G+M Sbjct: 140 DYINSRCRRCVGIGEDLAKNFFRQLTEGIM 169 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 251 LLQGRDVIAQAQSGTGKT 304 ++ GRDV+A AQ+G+GKT Sbjct: 168 VIAGRDVMACAQTGSGKT 185 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,583,943 Number of Sequences: 59808 Number of extensions: 493491 Number of successful extensions: 2296 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 2049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2280 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -