BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0689 (668 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL137477-1|CAB70758.1| 392|Homo sapiens hypothetical protein pr... 33 0.70 AK128694-1|BAC87575.1| 291|Homo sapiens protein ( Homo sapiens ... 32 1.6 >AL137477-1|CAB70758.1| 392|Homo sapiens hypothetical protein protein. Length = 392 Score = 33.5 bits (73), Expect = 0.70 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 364 CRLIC-LDKLTVYTTVRFSHSTLCIVSLSYSNLGIHCHLLIALNILLVVCLHRI 522 C C + T+++T +C + + Y++ GIH H L + VVC+ R+ Sbjct: 5 CTWYCSIHSATLFSTCTLHAYFMCFLCMLYASCGIHAHAPHMLRVNCVVCVWRV 58 >AK128694-1|BAC87575.1| 291|Homo sapiens protein ( Homo sapiens cDNA FLJ46861 fis, clone UTERU3011092. ). Length = 291 Score = 32.3 bits (70), Expect = 1.6 Identities = 18/84 (21%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +1 Query: 334 LCLESIKKVH-CRLICLDKLTVYTTVRFSHSTLCIVSLSYSNLGIHCHLLIALNILLVVC 510 +C+ +H C +C VY+ V H+ +C+ + ++ IH + + + I + C Sbjct: 135 MCIHMYTCIHICVFMCTMHAYVYSYVHM-HAYVCVHMYTCVHMCIHKYTCMHMCIHMYTC 193 Query: 511 LHRIQLCLVIKLQCTYSQHNLVLH 582 +HR C Y + +H Sbjct: 194 IHRCIFIYTYVYICVYIHIYICIH 217 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,815,049 Number of Sequences: 237096 Number of extensions: 1823794 Number of successful extensions: 2118 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2118 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7591280850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -