BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0688 (555 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55363-10|AAL11103.1| 364|Caenorhabditis elegans Hypothetical p... 29 3.0 U80027-15|AAC48116.2| 194|Caenorhabditis elegans Hypothetical p... 28 5.2 U64858-5|AAB18284.1| 409|Caenorhabditis elegans Hypothetical pr... 28 5.2 >U55363-10|AAL11103.1| 364|Caenorhabditis elegans Hypothetical protein ZC404.13 protein. Length = 364 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 196 GLSLNSYILKIQFFTIFIGVI*HF 267 GLS+N YI QFF++F ++ +F Sbjct: 289 GLSINDYINYFQFFSVFTNLLAYF 312 >U80027-15|AAC48116.2| 194|Caenorhabditis elegans Hypothetical protein T28A11.5 protein. Length = 194 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 369 YMNLMKKLYFMKYMSLDNLNIVEVFQLNLKNVVEKMLYYSNK 244 Y+N M K+YF+ S D++N + L + + E +NK Sbjct: 49 YVNFMAKMYFLDVKSQDSMNKFKTSCLFMADCTESFECQNNK 90 >U64858-5|AAB18284.1| 409|Caenorhabditis elegans Hypothetical protein C16D9.4 protein. Length = 409 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 198 PFIKFLYTKNSIFYNIYWSNITFFPQHFLGLAGIPRR 308 P F+++ +S F ++ S +TFFP + + L P R Sbjct: 286 PIYFFIHSSHSNFATLFKSLLTFFPTNSISLLKDPNR 322 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,946,952 Number of Sequences: 27780 Number of extensions: 141367 Number of successful extensions: 375 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1134321766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -