BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0684 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 1.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 1.6 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 4.8 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 8.4 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 401 YNALNNGPFKDIKTIIVINISTNIM 475 YN NN +KD + +N T+++ Sbjct: 304 YNKFNNNVYKDALIVCTVNSCTSML 328 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 401 YNALNNGPFKDIKTIIVINISTNIM 475 YN NN +KD + +N T+++ Sbjct: 357 YNKFNNNVYKDALIVCTVNSCTSML 381 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 28 ASINDFSAGVANRGSSIRIPRSVAEDKKGYLED 126 A+ DFS GV N S ++ + ++ LED Sbjct: 206 ATPTDFSMGVKNNHVSSKVEGNGVHEENSPLED 238 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 25 TASINDFSAGVANRGSSIRIPRSVAEDKKG 114 T S DF A +G +R +A+D +G Sbjct: 282 TLSKGDFFGEKALQGDDLRTANIIADDPEG 311 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,774 Number of Sequences: 438 Number of extensions: 3862 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -