BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0683 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 24 1.6 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 2.1 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 2.7 M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-... 23 3.6 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 8.3 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 8.3 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 69 KDKIESIRRKQYTERMRALRVMADLHYERYL 161 + + E R +Q R + L + + HY RYL Sbjct: 265 RSQFERKRGRQTYTRYQTLELEKEFHYNRYL 295 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 341 FFGKNFVPHNFFRKPYLLYTT*NLRIRF 258 +FGKNF +F Y ++ N +RF Sbjct: 6 YFGKNFPSTSFILINYFIFLYFNSLVRF 33 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/42 (21%), Positives = 22/42 (52%) Frame = +3 Query: 9 AEMDKEEKLRRITELREKRKKDKIESIRRKQYTERMRALRVM 134 + MD+ +++ R+ + + DK+ S+ R +R+ + M Sbjct: 439 SSMDRMDRMDRVDRMDTMDRTDKMSSMDRMDRMDRVDTMDTM 480 Score = 23.0 bits (47), Expect = 2.7 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +3 Query: 15 MDKEEKLRRITELREKRKKDKIESIRRKQYTERMRALRVMADLHYERYLM 164 MD+ + + R ++ + DKI+ + R T RM + M + Y+M Sbjct: 498 MDRMDTMDRTDKMSRIDRMDKIDRMDRMDRTNRMDRMNRM-NRQMNEYMM 546 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +3 Query: 15 MDKEEKLRRITELREKRKKDKIESIRRKQYTERM 116 MD+ +++ R+ + + DK+ I R +RM Sbjct: 489 MDRMDRMDRMDRMDTMDRTDKMSRIDRMDKIDRM 522 >M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H90. ). Length = 74 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 93 RKQYTERMRALRVMADLHYERYL 161 R+ YT R + L + + HY RYL Sbjct: 12 RQTYT-RYQTLELEKEFHYNRYL 33 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 660 LYRIYGKTIN*LLQRKCDHPP 598 L YG+ ++ L KC+H P Sbjct: 400 LLSAYGELLHALTSGKCEHRP 420 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 168 NYAIRPLKKLLEIKRYNVE 224 N + L K LEIK YN++ Sbjct: 92 NIKLYGLTKNLEIKNYNID 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,598 Number of Sequences: 438 Number of extensions: 3457 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -