BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0682 (719 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0726 + 10722759-10722857,10722969-10723058,10723141-107232... 30 1.6 08_02_1540 + 27694565-27694579,27696364-27696447,27696599-276967... 30 2.1 03_02_0873 - 11991947-11992059,11992148-11992337,11992437-119926... 29 2.8 05_04_0105 - 18026373-18026561,18027169-18027356,18027634-180276... 28 8.6 >03_02_0726 + 10722759-10722857,10722969-10723058,10723141-10723245, 10723597-10723698,10724721-10724805,10725281-10725365, 10725473-10725517,10725685-10728672,10728839-10729055, 10729193-10729765 Length = 1462 Score = 30.3 bits (65), Expect = 1.6 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 2/74 (2%) Frame = +3 Query: 6 RDDLNVLLAKMYGASVCDANEPSLTHVIVPECIAS--ETLNEMKKKHVDTISFVGMRWLE 179 R+D+ +++ M N +TH+I + E + K K I V RWLE Sbjct: 128 REDIMSMVSLMGAQFSKSLNPDVVTHLICYKFEGEKYEAAKKAKLKFNFNIKLVNHRWLE 187 Query: 180 ECFSQAKIINERDY 221 +C KI+ DY Sbjct: 188 DCLKCWKILPVDDY 201 >08_02_1540 + 27694565-27694579,27696364-27696447,27696599-27696731, 27696840-27696951,27697530-27697629,27697810-27697937, 27698046-27698115,27698548-27698636,27698719-27698764, 27698854-27698924,27699002-27699075,27699341-27699433, 27699539-27699572,27699704-27699789,27702147-27702223, 27702445-27702533,27702630-27702813,27703068-27703249, 27703962-27704064,27704159-27704490,27704577-27705018, 27705749-27705846,27706988-27707081,27707666-27707787, 27708025-27708078,27708185-27708304,27708595-27708799, 27708889-27709059,27709155-27709310,27709375-27709431, 27709474-27709580,27709708-27709798,27709931-27710072, 27710149-27710305,27710400-27710516,27710596-27710722, 27710844-27711066,27711460-27711466,27711656-27711788 Length = 1574 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = -1 Query: 332 CWDQCY--RYIQFLIKKGIMRLLYY*NNFKSRLDSALKQIVSFVDNFSLRKTFL 177 C +CY R + L+KK ++RL + +RLD+ L+++ V+ LR T L Sbjct: 478 CTQRCYVNRVLPALLKKHVVRLTKFDYRLANRLDTDLQKLRCRVNYHGLRFTGL 531 >03_02_0873 - 11991947-11992059,11992148-11992337,11992437-11992654, 11993409-11993503,11994201-11994406,11994658-11994750, 11994904-11994960,11995070-11995198,11996377-11996745 Length = 489 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = -1 Query: 311 YIQFLIKKGIMRLLYY*NNFKSRLDSALKQIVSFVDNFSLRKTFLEPPHTYKRYGIDMF 135 Y++ L+ KG LY + + L +A +I+ + R LE H RYG D+F Sbjct: 268 YVKELLLKGTTYYLYVHSYLRYGLLAARAEILKAGEGNDYRNCMLEGHHGQYRYGDDIF 326 >05_04_0105 - 18026373-18026561,18027169-18027356,18027634-18027692, 18027980-18028089,18028297-18028419 Length = 222 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 159 VGMRWLEECFSQAKIINERDYLF 227 V +WL+E F + K + E +Y+F Sbjct: 82 VSPKWLKESFKKGKFVGEAEYVF 104 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,514,326 Number of Sequences: 37544 Number of extensions: 328445 Number of successful extensions: 508 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -