BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0681 (666 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 3.9 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 22 5.2 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 6.9 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.1 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 9.1 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/28 (32%), Positives = 11/28 (39%) Frame = -1 Query: 246 TKHTNDRQWSPLLVDVINLTRRNKICCS 163 T N WSP +D L + C S Sbjct: 211 TNSANSSIWSPASIDSFTLEQHRSWCSS 238 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 21.8 bits (44), Expect = 5.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 357 NCMVRHKYTKHKHASSNNV 301 NC+V + YTK+ +N + Sbjct: 54 NCLVLNVYTKNLRTDTNRI 72 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 164 AFTTPYAHIVASFRGHN 114 AF YAH A + GH+ Sbjct: 439 AFHNQYAHYPAEYYGHH 455 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 374 CRCFIIIVWLDTSTLSTSMQAATMWNKSDKRV 279 C F+I++ L + + M +WN + RV Sbjct: 265 CPRFLIMLALSYTVIQEVMLFTILWNCQNTRV 296 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 9.1 Identities = 10/39 (25%), Positives = 16/39 (41%) Frame = +3 Query: 54 FISYLLNLSICLGHTTTINEIMSSKRGDYVGIRCSKCYN 170 F +L+ HTTT + + R RC + +N Sbjct: 269 FTRHLIQRRTHTRHTTTSHNTRGTPRTTPASSRCGQLFN 307 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,138 Number of Sequences: 336 Number of extensions: 3341 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -