BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0679 (681 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110478-4|CAB54346.1| 546|Caenorhabditis elegans Hypothetical ... 28 7.1 AC084197-27|AAG23467.2| 314|Caenorhabditis elegans Hypothetical... 27 9.4 >AL110478-4|CAB54346.1| 546|Caenorhabditis elegans Hypothetical protein Y26D4A.10 protein. Length = 546 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -2 Query: 293 LASSTRCYSLHYSQ*N*ITISLNHLHVDCRQRLAD 189 +ASST+CY L S+ N + I N + V RQ AD Sbjct: 388 IASSTKCYCLVMSE-NIVEIKDNRIKVISRQNEAD 421 >AC084197-27|AAG23467.2| 314|Caenorhabditis elegans Hypothetical protein Y73B6BL.21 protein. Length = 314 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 71 EYLMSTVVLWRDAEIFR*TFHSIYWIVCCKIFRNIRESMGPR 196 +YL + V+ W+ + F+ H + C + R IRES R Sbjct: 256 KYLANLVLPWQKEKNFKRAIHQFQRLNCQSLGREIRESASRR 297 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,804,196 Number of Sequences: 27780 Number of extensions: 296953 Number of successful extensions: 687 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -