BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0677 (694 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC065033-1|AAH65033.1| 146|Homo sapiens FLJ20489 protein protein. 33 0.97 BC002759-1|AAH02759.2| 89|Homo sapiens FLJ20489 protein protein. 33 0.97 >BC065033-1|AAH65033.1| 146|Homo sapiens FLJ20489 protein protein. Length = 146 Score = 33.1 bits (72), Expect = 0.97 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +3 Query: 474 VRVLYS*IILAIFCTSFYIITITRNRLR*DPVRKILSCIFVIIFF 608 V VL+S + +A FCT F ++ ITR++ DP LS ++ I F Sbjct: 77 VGVLFSAVSIAAFCT-FLVLAITRHQSLTDPTSYYLSSVWSFISF 120 >BC002759-1|AAH02759.2| 89|Homo sapiens FLJ20489 protein protein. Length = 89 Score = 33.1 bits (72), Expect = 0.97 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +3 Query: 474 VRVLYS*IILAIFCTSFYIITITRNRLR*DPVRKILSCIFVIIFF 608 V VL+S + +A FCT F ++ ITR++ DP LS ++ I F Sbjct: 20 VGVLFSAVSIAAFCT-FLVLAITRHQSLTDPTSYYLSSVWSFISF 63 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,329,934 Number of Sequences: 237096 Number of extensions: 1289977 Number of successful extensions: 1344 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1344 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7951235188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -