BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0675 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pomb... 31 0.16 SPAC7D4.13c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 5.9 SPAC607.09c |btn1||battenin CLN3 family protein|Schizosaccharomy... 25 7.8 >SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1073 Score = 31.1 bits (67), Expect = 0.16 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = -3 Query: 629 FNTDIVFPKQIYIKLSRNIEALYVCHNIILHIIFF---TKLNMCNTLMCILIQNNSRQR 462 F DIVF + LS+ + A IILH IF + C T +C+ + +NS R Sbjct: 141 FAGDIVFFFSHHPSLSKQVFAQLSIDGIILHTIFVPPKRSSSSCVTYVCLFLDSNSNPR 199 >SPAC7D4.13c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 312 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 Query: 399 HLY*LVNYQIFMKNNNDVNWKMFCRHNFKFE 307 HL V Y + + D++W R N KFE Sbjct: 129 HLLSFVPYPMTAETLGDISWSFSRRENMKFE 159 >SPAC607.09c |btn1||battenin CLN3 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 396 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +1 Query: 229 VKKKLISKR*FIISLICKCTSSYLNIFEFKIMPAKHFPVYIVII 360 V K ++ + SL CK ++S L++ +FK F V++ I+ Sbjct: 42 VSKGVVLLSNIVPSLACKLSASILHVHKFKFAKRIGFCVFMSIL 85 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,781,539 Number of Sequences: 5004 Number of extensions: 57525 Number of successful extensions: 111 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -