BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0673 (633 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC306.07c |||U3 snoRNP-associated protein Cic1/Utp30 family|Sc... 28 1.3 SPAC1851.03 |ckb1||CK2 family regulatory subunit |Schizosaccharo... 26 3.9 >SPCC306.07c |||U3 snoRNP-associated protein Cic1/Utp30 family|Schizosaccharomyces pombe|chr 3|||Manual Length = 284 Score = 27.9 bits (59), Expect = 1.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 492 TKKLNINRIRSKFCKLREPCALFVSHSFY 578 TK L+I R++ K+ +RE C L SH+ + Sbjct: 103 TKVLSIPRLKLKYKTIREKCELRDSHNLF 131 >SPAC1851.03 |ckb1||CK2 family regulatory subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 231 Score = 26.2 bits (55), Expect = 3.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 376 HSWNSLLAEQQMGKEKMRSSLQG*HRQXTNK 468 HS+++ +Q + KEK + LQG + NK Sbjct: 197 HSYSATFKKQDVYKEKQKKRLQGAEAESKNK 227 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,493,967 Number of Sequences: 5004 Number of extensions: 47829 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -