BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0673 (633 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) 30 1.8 SB_15716| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.1 SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) 28 7.2 >SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) Length = 933 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -3 Query: 244 KSNALLKLPPDRNRDPLSRSRSARNSMHSSMG 149 +S ALL L P R+R+P+ R+ S N++ S G Sbjct: 453 ESGALLNLTPARSRNPVQRNESYCNAVSRSPG 484 >SB_15716| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 502 NFFVK*KLCLFVCLXFGDANLGAKTAFSPYPFAVRLGGYS 383 N+F+ LC+F+ L FGD + F P + L G+S Sbjct: 1159 NYFIPAMLCVFIFLAFGDESYTTAMNFPPTFCLLLLYGWS 1198 >SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) Length = 2074 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 355 QLTYPSGHSWNSLLAEQQMGKEKMRSSLQG*HRQXT 462 QL P GHS++ L MG K R + HR+ T Sbjct: 79 QLFVPLGHSFSFELGITDMGNNKRRIFMSSSHREVT 114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,193,728 Number of Sequences: 59808 Number of extensions: 343916 Number of successful extensions: 549 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -