BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0672 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54381| Best HMM Match : Trigger_C (HMM E-Value=0.55) 28 8.3 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_54381| Best HMM Match : Trigger_C (HMM E-Value=0.55) Length = 607 Score = 27.9 bits (59), Expect = 8.3 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 14/85 (16%) Frame = -2 Query: 474 THKIYNKIIIEVNIRSQNKTS-----------STKI*NQLRSLYIHSKTLIKKKRIYYN- 331 T+K+ NK+ +VN + NK + + K+ N++ + + T K++ N Sbjct: 194 TYKVTNKVTYKVNNKVTNKVTKNVTNKVTNNVTNKVTNEVTNKVNNKVTNKVTKKVTNNV 253 Query: 330 THCTNHNYT--VLHNIVNQVVSKVS 262 T+ N+N T V +N+ N+V +KV+ Sbjct: 254 TNKVNNNVTNKVTNNVTNKVTNKVA 278 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/57 (22%), Positives = 29/57 (50%) Frame = -2 Query: 387 RSLYIHSKTLIKKKRIYYNTHCTNHNYTVLHNIVNQVVSKVSILYLLHLNYTKSELK 217 R+LY + T+ +KK + +N H + + V +N + +++ + LN + +K Sbjct: 414 RTLYYNMNTVPQKKVMTFNKHTDDFQFHVSYNGLEDLMNPADLAMFGELNVSTVSVK 470 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,249,461 Number of Sequences: 59808 Number of extensions: 328722 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -