BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0671 (458 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 7.3 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 7.3 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 20.6 bits (41), Expect = 7.3 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = -2 Query: 316 PGSHRFELRSCKILMIEQIKI*TSTFKFYLNPTSRSQTFLFI*TKKKNYAVIP 158 P + R +I + I + +S ++ L+P SR T + Y V+P Sbjct: 376 PAADELLRRFHEIRYMSTIDLRSSYWQIPLSPESRQYTAFLYNGRSYTYQVLP 428 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 20.6 bits (41), Expect = 7.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 319 QPGSHRFELRSCK 281 QPG +R +L SCK Sbjct: 10 QPGVNRCKLLSCK 22 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,378 Number of Sequences: 336 Number of extensions: 1530 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -