SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0671
         (458 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    21   7.3  
AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     21   7.3  

>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 20.6 bits (41), Expect = 7.3
 Identities = 13/53 (24%), Positives = 23/53 (43%)
 Frame = -2

Query: 316 PGSHRFELRSCKILMIEQIKI*TSTFKFYLNPTSRSQTFLFI*TKKKNYAVIP 158
           P +     R  +I  +  I + +S ++  L+P SR  T      +   Y V+P
Sbjct: 376 PAADELLRRFHEIRYMSTIDLRSSYWQIPLSPESRQYTAFLYNGRSYTYQVLP 428


>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 20.6 bits (41), Expect = 7.3
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -2

Query: 319 QPGSHRFELRSCK 281
           QPG +R +L SCK
Sbjct: 10  QPGVNRCKLLSCK 22


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,378
Number of Sequences: 336
Number of extensions: 1530
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 10511300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -