BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0671 (458 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.8 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 6.8 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 6.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 327 IETNLAHTGLNSDHVRF 277 I+ + +HT ++ DHVRF Sbjct: 1455 IKPSESHTSIDVDHVRF 1471 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 22.6 bits (46), Expect = 6.8 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +3 Query: 174 FFFLVQIKRKV--CDLDVGLR*NLNVEV*ILICSIIKILHDLSSNRCEP 314 F VQ R V C+L L L++ I I +++DL +N C P Sbjct: 239 FILGVQATRNVIRCELIALLLHYLHLSTSIWCFIYIYVIYDLIANECTP 287 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 313,375 Number of Sequences: 2352 Number of extensions: 5010 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -