BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0667 (694 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 27 0.19 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 7.2 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 9.6 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 26.6 bits (56), Expect = 0.19 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = -1 Query: 478 HKLQQTVVERXDIFTSLPLFDFVISKHFNIGDFFNASNLYGLDAKLLLVTPSFLVDFRVV 299 + LQ+ V++ IF +LP + + + N +FN ++G + +L F V ++ Sbjct: 118 YHLQKINVQQSGIFINLPFLEHNLIRLKNCVIYFN--RIFGWN---ILFGHIFTVCRTLI 172 Query: 298 LIDD-VDGASPRKSVSSSK 245 IDD V G + +++SSK Sbjct: 173 YIDDNVKGLGKQYNIASSK 191 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.4 bits (43), Expect = 7.2 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 623 ISERLSDNSFFGTSSFSEIGPRAGLRNTGLLFSLSMLP 510 I E+ ++ T+ EI R R+ GLL ++S+LP Sbjct: 178 IDEKAEEHKEQFTALVREI--RNAFRHDGLLLTMSVLP 213 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 Query: 478 DVIEEKAHFDAGNMLRLNRSPV 543 DVI HF A LNR + Sbjct: 479 DVINHFPHFTAARFFDLNRKTI 500 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,973 Number of Sequences: 336 Number of extensions: 2343 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -