BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0666 (695 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyc... 27 2.6 SPAP14E8.04 |oma1||metallopeptidase Oma1 |Schizosaccharomyces po... 26 5.9 >SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 781 Score = 27.1 bits (57), Expect = 2.6 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = +3 Query: 477 QRLPHLLNPNAHGRNRQGG-CTYPRG-LTSGPTTSN 578 ++ P L+PN+ RNR+GG +Y G LT+ PT S+ Sbjct: 246 RKKPSPLSPNSSIRNREGGNGSYFDGPLTASPTPSS 281 >SPAP14E8.04 |oma1||metallopeptidase Oma1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 337 Score = 25.8 bits (54), Expect = 5.9 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -3 Query: 285 INSVTRVNKVRLVQVMSYKRIRRNTARGSDAARFRT---TVTHRRYVIYIRTNPN 130 I++ +R V V+SYK+ G ARF++ + ++R V+Y PN Sbjct: 7 ISNYSRTRAVSCAPVLSYKKCSYRNFNGLLQARFQSNNLSWSNRNRVVYKSFQPN 61 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,759,244 Number of Sequences: 5004 Number of extensions: 54757 Number of successful extensions: 111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -