BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0666 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0072 + 11152988-11153102,11153581-11153705,11153860-111540... 32 0.38 01_01_0562 + 4126368-4128196,4128517-4128715,4128827-4128886,412... 28 6.2 >06_02_0072 + 11152988-11153102,11153581-11153705,11153860-11154004, 11154219-11154284,11154418-11154540,11154839-11154961, 11156065-11156193,11156510-11156632,11156737-11156838, 11156943-11157065,11157169-11157270,11157370-11157492, 11157791-11157913,11158209-11158331,11158633-11158761, 11160210-11161039 Length = 867 Score = 32.3 bits (70), Expect = 0.38 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +1 Query: 133 RVGTYVNNVASMRDRSAETGSVASARRVP-PYPLIA-HYLHQPYLVNTCHAVYICCRYS 303 R G Y NV S+R+ SA GS +S+ P P ++A H L PY V CH+ Y+ Sbjct: 732 RRGRY--NVTSVRELSAMAGSGSSSSSEPAPAAVVACHDLTYPYAVFYCHSTKPTAAYA 788 >01_01_0562 + 4126368-4128196,4128517-4128715,4128827-4128886, 4129129-4129233,4129987-4130127,4130223-4130285, 4130925-4131152,4131250-4131333,4132000-4132157, 4132252-4132777,4133641-4133700,4133904-4134026, 4134906-4135181,4135282-4135347,4135500-4135631, 4135977-4136798,4137026-4137306,4137564-4137796, 4138022-4138260,4138367-4138558,4138808-4139080, 4139186-4139332 Length = 2078 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 456 LRSQV*LQRLPHLLNPNAHGRNRQGGCTY 542 LR+ L P LL+P+ R+RQGGC + Sbjct: 5 LRASPFLSPPPPLLHPSRRRRHRQGGCIH 33 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,291,161 Number of Sequences: 37544 Number of extensions: 339425 Number of successful extensions: 720 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -