BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0666 (695 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001629-1|AAN71384.1| 805|Drosophila melanogaster RE37929p pro... 29 8.0 AE014297-4755|AAN14274.1| 833|Drosophila melanogaster CG1499-PB... 29 8.0 AE014297-4754|AAF57159.1| 833|Drosophila melanogaster CG1499-PA... 29 8.0 >BT001629-1|AAN71384.1| 805|Drosophila melanogaster RE37929p protein. Length = 805 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 252 LVQVMSYKRIRRNTARGSDAARFRTTVTHRRYV 154 L ++SY R +R+ G+D A F + HRR V Sbjct: 626 LKSLVSYGRKKRSVLNGTDGAEFLISTRHRRDV 658 >AE014297-4755|AAN14274.1| 833|Drosophila melanogaster CG1499-PB, isoform B protein. Length = 833 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 252 LVQVMSYKRIRRNTARGSDAARFRTTVTHRRYV 154 L ++SY R +R+ G+D A F + HRR V Sbjct: 626 LKSLVSYGRKKRSVLNGTDGAEFLISTRHRRDV 658 >AE014297-4754|AAF57159.1| 833|Drosophila melanogaster CG1499-PA, isoform A protein. Length = 833 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 252 LVQVMSYKRIRRNTARGSDAARFRTTVTHRRYV 154 L ++SY R +R+ G+D A F + HRR V Sbjct: 626 LKSLVSYGRKKRSVLNGTDGAEFLISTRHRRDV 658 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,216,843 Number of Sequences: 53049 Number of extensions: 587336 Number of successful extensions: 1264 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1264 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3046624548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -