BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0663 (350 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces... 25 2.6 SPCC1620.13 |||phosphoglycerate mutase family|Schizosaccharomyce... 24 6.0 SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 24 7.9 SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces po... 24 7.9 >SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 25.4 bits (53), Expect = 2.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +1 Query: 22 NVAINYKNISNFFHGTRKCK*KFET*NVKHRYLLNFFSSNF*SITKNN 165 N + YKNI N F +R + E N+K + F SNF +K N Sbjct: 14 NNELLYKNIRNLFSTSRSFPIEQEWMNLKSISQMKDFFSNFPGNSKAN 61 >SPCC1620.13 |||phosphoglycerate mutase family|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 24.2 bits (50), Expect = 6.0 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 279 LHNILLELRNASFCLTNMLVYSNTFAKFKC 190 L ++++ NAS+CL + + N+ K C Sbjct: 220 LPSMIIPWNNASYCLITIDLGGNSIVKMNC 249 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 23.8 bits (49), Expect = 7.9 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +2 Query: 113 DIS*TFFHQIFNQSLKTIFKASTHNI-HLN 199 DIS F+ ++NQS+ I + +I H+N Sbjct: 361 DISSAIFYSVWNQSIAAIIRREKVDIYHIN 390 >SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 875 Score = 23.8 bits (49), Expect = 7.9 Identities = 10/16 (62%), Positives = 13/16 (81%), Gaps = 1/16 (6%) Frame = +2 Query: 173 ASTHNIHLNLAN-VFE 217 A HN+HL+LAN +FE Sbjct: 736 ALNHNVHLHLANMIFE 751 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,154,943 Number of Sequences: 5004 Number of extensions: 20968 Number of successful extensions: 37 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 106195544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -