BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0658 (633 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.5 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = -3 Query: 547 GPPDGECLPSPMDSVXPGAELSRCPQMFHQTAGESAHLMLS 425 GP E P ++S + C M+H+T E + S Sbjct: 515 GPQITELEPETIESQDAITRIYACGTMWHETPEEMMEFLKS 555 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.5 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = -3 Query: 547 GPPDGECLPSPMDSVXPGAELSRCPQMFHQTAGESAHLMLS 425 GP E P ++S + C M+H+T E + S Sbjct: 515 GPQITELEPETIESQDAITRIYACGTMWHETPEEMMEFLKS 555 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 544 PPDGECLPSPMDSVXPGAELSRCP 473 P G +P P S PG+ S+ P Sbjct: 1105 PLKGTAVPPPSGSSGPGSTGSKSP 1128 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,770 Number of Sequences: 336 Number of extensions: 2551 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -