BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0658 (633 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.9 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.9 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.9 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.9 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 22 5.7 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 22 5.7 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 22 5.7 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.9 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 614 PNPCPHDTTPLC 579 PNPC H TT C Sbjct: 432 PNPCTHTTTNGC 443 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 614 PNPCPHDTTPLC 579 PNPC H TT C Sbjct: 418 PNPCTHTTTNGC 429 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 614 PNPCPHDTTPLC 579 PNPC H TT C Sbjct: 452 PNPCTHTTTNGC 463 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 614 PNPCPHDTTPLC 579 PNPC H TT C Sbjct: 401 PNPCTHTTTNGC 412 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -3 Query: 547 GPPDGECLPSPMDSVXPGAELSR 479 G D E P+P + PG ++++ Sbjct: 373 GRADEEAAPAPQHLIHPGKDINK 395 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -3 Query: 547 GPPDGECLPSPMDSVXPGAELSR 479 G D E P+P + PG ++++ Sbjct: 373 GRADEEAAPAPQHLIHPGKDINK 395 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -3 Query: 547 GPPDGECLPSPMDSVXPGAELSR 479 G D E P+P + PG ++++ Sbjct: 311 GRADEEAAPAPQHLIHPGKDINK 333 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 9.9 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = +3 Query: 483 LSSAPGITESMGDGKHSPSGGPYALXAYKGNKTKRCGVVGTRVRIRSSSI 632 + SA I DGKH + L +Y G K ++G I + + Sbjct: 166 IRSAITIFPQRTDGKHDYRVWNHQLISYAGYKNPDGTIIGDPANIEFTEL 215 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,397 Number of Sequences: 438 Number of extensions: 2778 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -