BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0657 (662 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58760-8|AAY55858.2| 216|Caenorhabditis elegans Hypothetical pr... 27 9.0 AL032660-1|CAA21752.1| 711|Caenorhabditis elegans Hypothetical ... 27 9.0 >U58760-8|AAY55858.2| 216|Caenorhabditis elegans Hypothetical protein C27A2.7 protein. Length = 216 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 487 HKPNXYSHSFTVHAIRLWNSLPADIRVCKSV 395 HK +S++F V+ LW P D RV K V Sbjct: 103 HKAIYHSYNFCVYKCILWRFSPQDQRVWKCV 133 >AL032660-1|CAA21752.1| 711|Caenorhabditis elegans Hypothetical protein Y70G10A.2 protein. Length = 711 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 527 GASGERMKENRSRKYKGEXGLCXILNRGLIFG 622 G +G+R ++ +S++YKG+ G ++ + G Sbjct: 193 GYAGDRCEKEKSKEYKGDLGYSSVVGATITLG 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,742,504 Number of Sequences: 27780 Number of extensions: 265107 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -