BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0656 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0264 + 32738224-32738553,32739298-32739768,32739864-327400... 37 0.013 11_01_0697 - 5743089-5744902,5745091-5745751,5747918-5748910 29 4.7 >03_06_0264 + 32738224-32738553,32739298-32739768,32739864-32740007, 32740570-32740671,32741758-32741873,32741959-32742028, 32742308-32742376,32742898-32742948,32743038-32743196 Length = 503 Score = 37.1 bits (82), Expect = 0.013 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 3/56 (5%) Frame = -2 Query: 395 RKFKLFKPFFINNISMNTFI*KITCKF*TSSVLI---HPSDGFHKLLYIASSAATV 237 +K KL PFFI N ++ TF IT + S VL+ +PS+G HKL+Y A AATV Sbjct: 326 KKVKLSIPFFIPNFTLGTFG-AITQLY-VSKVLVRNSYPSNG-HKLIYRAMHAATV 378 >11_01_0697 - 5743089-5744902,5745091-5745751,5747918-5748910 Length = 1155 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 354 NIVYEEWFEKLELPDTLASWFSITELHVWLLMVRYMAEDIAH 479 ++ E W+ + +LP+ L S+ EL + + EDI H Sbjct: 1023 SLTLERWYNQAQLPNWLGQLVSLKELKINRFEMNESQEDIKH 1064 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,280,885 Number of Sequences: 37544 Number of extensions: 299463 Number of successful extensions: 610 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -