BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0655 (691 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IIG7 Cluster: Putative uncharacterized protein; n=5; ... 33 8.7 UniRef50_Q7QSP1 Cluster: GLP_327_24821_23835; n=1; Giardia lambl... 33 8.7 >UniRef50_Q8IIG7 Cluster: Putative uncharacterized protein; n=5; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 964 Score = 32.7 bits (71), Expect = 8.7 Identities = 17/41 (41%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = +1 Query: 82 ESNLGY--IYINEVCNLIRLFFNYITNEVVINHYFNVTDVI 198 E +L Y IY ++V N+I+ F+N I ++++ N+YFN D I Sbjct: 849 EEHLKYNNIYKHDV-NIIKNFYNEIKDKIIQNYYFNQDDCI 888 >UniRef50_Q7QSP1 Cluster: GLP_327_24821_23835; n=1; Giardia lamblia ATCC 50803|Rep: GLP_327_24821_23835 - Giardia lamblia ATCC 50803 Length = 328 Score = 32.7 bits (71), Expect = 8.7 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -1 Query: 424 PDVKWLLETSTTQMPPPALVHNIGSQ*LQQLPHPSNR 314 PD ++LE+ Q+ PP L+H +G + L +P ++R Sbjct: 150 PDTIYVLESGVAQLGPPPLLHLLGIRQLSDMPTSAHR 186 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,653,541 Number of Sequences: 1657284 Number of extensions: 12338812 Number of successful extensions: 22807 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22802 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54132236449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -