BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0655 (691 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 24 5.2 DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 24 5.2 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 24 5.2 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 24 5.2 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 24 5.2 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 573 LLSMERPTCGGIILLCISELYFIYY 499 L M RP GI+L I E+Y Y+ Sbjct: 146 LTVMHRPDLQGIVLPAIYEIYPYYF 170 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 23.8 bits (49), Expect = 5.2 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -3 Query: 404 GDIYNANAATRLGT*YRVSVVTTAAPSFKPKRITASEIGRVV-VPTRADSQRYTTS 240 GD+++ +L VSV+T A F P TA E+ + + PT+ S +TT+ Sbjct: 167 GDVFSLPPCHKLMLFSGVSVLTPLAIRFNPAD-TALELFQFINAPTQRVSTMHTTA 221 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 573 LLSMERPTCGGIILLCISELYFIYY 499 L M RP GI+L I E+Y Y+ Sbjct: 146 LTVMHRPDLQGIVLPAIYEIYPYYF 170 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 573 LLSMERPTCGGIILLCISELYFIYY 499 L M RP GI+L I E+Y Y+ Sbjct: 146 LTVMHRPDLQGIVLPAIYEIYPYYF 170 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 573 LLSMERPTCGGIILLCISELYFIYY 499 L M RP GI+L I E+Y Y+ Sbjct: 146 LTVMHRPDLQGIVLPAIYEIYPYYF 170 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,978 Number of Sequences: 2352 Number of extensions: 13196 Number of successful extensions: 66 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -