BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0654 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0117 - 18300157-18301106,18301149-18301543,18302592-183026... 29 3.5 01_05_0660 - 24071523-24071780,24071873-24072127,24072209-240723... 28 8.1 >01_05_0117 - 18300157-18301106,18301149-18301543,18302592-18302681, 18303723-18303836,18303903-18304046,18316147-18316312, 18316396-18317130,18317219-18317422,18317496-18318177, 18318272-18318528,18318604-18319298,18319345-18319382, 18319847-18319928,18320018-18320112,18320443-18320526, 18320601-18320891,18321521-18321853,18321948-18322150, 18322243-18322399,18322482-18322585,18322675-18322835, 18323511-18323824,18324317-18324589,18324666-18324967, 18325459-18325549,18326140-18326190,18326700-18326768, 18326926-18327017,18327082-18327148,18328582-18328746, 18329027-18329103,18329572-18329766,18330208-18330275, 18331081-18331172,18331399-18331522,18331608-18331705, 18332384-18332997,18333620-18333626 Length = 2892 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/42 (30%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 307 FSEKLLFCP-YKYTFQFYFLKLPLNLVCLSVY**LSCYI*GF 185 F+++ +F P + YTF + LK+P+ L+ ++++ ++ Y GF Sbjct: 853 FTQRDVFYPAWAYTFPTWILKIPITLIQVTIWVTMTYYPIGF 894 >01_05_0660 - 24071523-24071780,24071873-24072127,24072209-24072380, 24072458-24072685,24072785-24072918,24073005-24073088, 24073231-24073521,24073599-24073931,24074016-24074266, 24074354-24074620,24074707-24074867,24074978-24075294, 24075386-24075667,24075753-24076054,24076147-24076237, 24076326-24076379,24076497-24076573,24076700-24076859, 24077129-24077213,24077421-24077630,24077736-24078097 Length = 1457 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 295 LLFCP-YKYTFQFYFLKLPLNLVCLSVY**LSCYI*GFCS 179 LLF P + YT + LK+P+ + + Y L+ Y+ GF S Sbjct: 604 LLFYPAWSYTIPSWILKIPITFIEVGGYVFLTYYVIGFDS 643 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,209,876 Number of Sequences: 37544 Number of extensions: 259563 Number of successful extensions: 467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -