BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0653 (631 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC26H8.01 |thi2|nmt2|thiazole biosynthetic enzyme|Schizosaccha... 26 5.2 SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccha... 26 5.2 SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 26 5.2 >SPBC26H8.01 |thi2|nmt2|thiazole biosynthetic enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 328 Score = 25.8 bits (54), Expect = 5.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 168 T*W*VVTVAHGLQQCQGQSQAAAYLLI 248 T W +V++ HGLQ C + A+L++ Sbjct: 201 TNWTLVSLNHGLQSCMDPNTINAHLVV 227 >SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccharomyces pombe|chr 2|||Manual Length = 605 Score = 25.8 bits (54), Expect = 5.2 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 320 IAGWYVAKKISGNA-LWMXAVAPGSMDELYSGGGRCDG 430 I +Y A + G+ + M + GSMD+LY+GG + +G Sbjct: 378 IVDFYGAFFVEGSVFICMEYMDAGSMDKLYAGGIKDEG 415 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 25.8 bits (54), Expect = 5.2 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 473 TPHGTYGIKYRGTEVPPQTQRLQ-TIRENGDYRQS*RASSVWSPMEEAGI 619 T G + ++ R +P + Q + TIREN D + +W +E A + Sbjct: 1290 TSIGLHDLRSRLAIIPQENQAFEGTIRENLDPNANATDEEIWHALEAASL 1339 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,916,757 Number of Sequences: 5004 Number of extensions: 62692 Number of successful extensions: 177 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -