BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0652 (697 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1663 + 38980710-38981052,38981826-38982967 28 6.2 01_05_0681 - 24242485-24242560,24242721-24242785,24242874-242430... 28 6.2 >01_06_1663 + 38980710-38981052,38981826-38982967 Length = 494 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 296 PGAVNSNPYYFPGLKLLRFIPNFIKIISE 382 P V + P+YF L +LR + NF++ + + Sbjct: 167 PAVVATKPHYFRDLDVLRTVENFLEYVPD 195 >01_05_0681 - 24242485-24242560,24242721-24242785,24242874-24243029, 24243073-24243121,24243291-24243366,24243456-24243666, 24244038-24244160,24244245-24244363,24244439-24244532, 24245123-24245233,24245336-24245392 Length = 378 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 360 ISSKSFQRSESGNITDMVTYFCIDII---IYYITFNHREYQGNYKEVMMKTLE 509 I + + SG ++V F I+ + +Y + F HR YQGN + + L+ Sbjct: 16 IGGMRYSLAASGARAEVVEAFDINDVANDVYELNFGHRPYQGNIQTLTASDLD 68 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,919,254 Number of Sequences: 37544 Number of extensions: 289910 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -