BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0651 (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.19c ||SPAC26H5.01c|RecQ type DNA helicase Hrq1 |Schizos... 27 1.9 SPBPJ4664.04 |||coatomer alpha subunit |Schizosaccharomyces pomb... 27 3.4 >SPAC23A1.19c ||SPAC26H5.01c|RecQ type DNA helicase Hrq1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1063 Score = 27.5 bits (58), Expect = 1.9 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 159 KLLMIHNVFILYITL--DFVQYS*IRNIIRLLKHVETNVYF 275 +++ H V + + TL DF +R++++ H TN+YF Sbjct: 811 RIITAHQVDVEWSTLQRDFTDVDPVRSLMKKTMHGSTNIYF 851 >SPBPJ4664.04 |||coatomer alpha subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 1207 Score = 26.6 bits (56), Expect = 3.4 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 171 IHNVFILYITLDFVQYS*IRNIIRLLKHVETNVYFV 278 + N +LY TLD ++Y+ + ++K +E+ +Y V Sbjct: 543 VENNVLLYATLDHLKYALMSGDTGVIKTLESTLYLV 578 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,408,633 Number of Sequences: 5004 Number of extensions: 43955 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -