BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0650 (695 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.03c |mts4|rpn1|19S proteasome regulatory subunit Mts4|... 29 0.84 SPCC126.13c |||histone deacetylase complex subunit, SAP128 famil... 26 4.5 >SPBP19A11.03c |mts4|rpn1|19S proteasome regulatory subunit Mts4|Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 28.7 bits (61), Expect = 0.84 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +2 Query: 302 IASIKRYYFKGAKQLIQKNVHFNLLSIRRGTDNLNDYRLH*HIALSKDSFADLL*III 475 + + YY K + L + LL + +GT LN Y I L + +FA L+ +++ Sbjct: 726 LRQLASYYHKESNALFMVRIAQGLLYLGKGTMTLNPYHTERQI-LGQTAFAGLMTVVL 782 >SPCC126.13c |||histone deacetylase complex subunit, SAP128 family |Schizosaccharomyces pombe|chr 3|||Manual Length = 145 Score = 26.2 bits (55), Expect = 4.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 253 YFD*YKLRRVPILLGVNCVNQALLFQGRK 339 ++D YK R + LG C++ LFQG K Sbjct: 91 FYDKYKDRPIARDLGTVCLHNPKLFQGNK 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,154,498 Number of Sequences: 5004 Number of extensions: 38343 Number of successful extensions: 91 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -