BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0649 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 pr... 27 0.46 AY748832-1|AAV28180.1| 69|Anopheles gambiae cytochrome P450 pr... 27 0.60 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 25 1.4 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 1.4 AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 pr... 25 1.8 AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CY... 25 1.8 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 24 3.2 AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 24 3.2 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 24 4.3 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 24 4.3 AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CY... 24 4.3 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 5.6 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 5.6 AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 23 7.4 AY745213-1|AAU93480.1| 171|Anopheles gambiae cytochrome P450 pr... 23 7.4 AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CY... 23 7.4 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.4 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.4 AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.4 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 23 7.4 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.4 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 7.4 DQ004401-1|AAY21240.1| 153|Anopheles gambiae lysozyme c-7 protein. 23 9.8 >AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 protein. Length = 147 Score = 27.1 bits (57), Expect = 0.46 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 358 MSDELITRIVADFVIAAGDTTAYTSLWILFLLSNNTEI 471 ++DE + V F+ DTT W LFLL+ + E+ Sbjct: 35 LTDEDVREEVDTFMFEGHDTTTAGMSWALFLLALHPEV 72 >AY748832-1|AAV28180.1| 69|Anopheles gambiae cytochrome P450 protein. Length = 69 Score = 26.6 bits (56), Expect = 0.60 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 495 PIRENVVKEAMRLYPVAPFLPEFT 566 P + V+KE++RLYP F+ T Sbjct: 29 PYLDRVIKESLRLYPPVAFISRTT 52 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 25.4 bits (53), Expect = 1.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 504 ENVVKEAMRLYPVAPFLP-EFTPTMCFG 584 E V+KE++RLYP P + FT + G Sbjct: 62 ELVIKESLRLYPPVPIIARRFTENVELG 89 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 173 FSTTTKLYALPVEFCQRWNLKVWRNFKHPLMIPSLSLR 286 F TKL+AL +E+C+ NL +F+ + +L+LR Sbjct: 93 FKQLTKLHALSIEYCKIANLSE-GSFQGLKQLVNLTLR 129 >AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 25.0 bits (52), Expect = 1.8 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 325 DGLVKRLKDENM-SDELITRIVADFVIAAGDTTAYTSLWILFLLSNNTEI 471 D L++ + N+ +D + V F+ DTT W LFLL+ + +I Sbjct: 8 DMLLESNEQNNLLTDNDVREEVDTFMFEGHDTTTAGMCWALFLLALHPDI 57 >AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CYP4C26 protein. Length = 154 Score = 25.0 bits (52), Expect = 1.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 385 VADFVIAAGDTTAYTSLWILFLLSNNTEI 471 V F+ DTTA WIL+LL +I Sbjct: 2 VDTFMFEGHDTTAAAMAWILYLLGAAPDI 30 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 17 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 49 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 17 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 49 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 17 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 49 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 17 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 49 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 20 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 52 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 20 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 52 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 31 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 63 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 31 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 63 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 17 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 49 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 17 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 49 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 31 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 63 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 31 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 63 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 31 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 63 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 31 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 63 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 16 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 48 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 16 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 48 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 29 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 61 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 30 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 62 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 30 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 62 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 355 NMSDELITRIVADFVIAAGDTTAYTSLWILFLL 453 N+SDE I V + DTTA S ++L LL Sbjct: 28 NISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLL 60 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 24.2 bits (50), Expect = 3.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 504 ENVVKEAMRLYPVAPFL 554 + VVKE +R+YP FL Sbjct: 142 DQVVKETLRMYPPVDFL 158 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 385 VADFVIAAGDTTAYTSLWILFLLSNNTEI 471 V F+ DTTA W+L+LL + + Sbjct: 2 VDTFMFEGHDTTAIALAWMLYLLGTDQTV 30 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 504 ENVVKEAMRLYPVAPF 551 E +KEA+RLYP F Sbjct: 62 ERCIKEALRLYPSVSF 77 Score = 23.4 bits (48), Expect = 5.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 385 VADFVIAAGDTTAYTSLWILFLLSNNTEI 471 V F+ DTT W+LFLL+ + ++ Sbjct: 2 VDTFMFEGHDTTTAGISWVLFLLALHPDV 30 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 23.8 bits (49), Expect = 4.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 510 VVKEAMRLYPVAPFL 554 V+KE +RLYP P + Sbjct: 64 VIKETLRLYPSVPMI 78 >AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CYP4H17 protein. Length = 151 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 510 VVKEAMRLYPVAPFL 554 VVKE++RL P PF+ Sbjct: 65 VVKESLRLVPPVPFI 79 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 5.6 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = -1 Query: 494 SLSFIXVKISVLFESKNNIQSDV*AVVSPAAMTKSATILVINSSDIFSSFSLFTKPSPAS 315 SL +I V+++ NN V V P ++ + L + D SSF+L KPS Sbjct: 168 SLEYICVRVAC-----NNAHLYVMVVYIPPQLSSEISTLR-SLHDCISSFTLRLKPSDLL 221 Query: 314 FV 309 FV Sbjct: 222 FV 223 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 5.6 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = +1 Query: 193 ICFTRRILPT--MEFKSVEKFQTSVDDSISIAQKIVYEMLHTKDAGDGLVKRLKDENMSD 366 ICFT R LPT + K+ EK VD A V ++ + +++ + +MS+ Sbjct: 1979 ICFTSRPLPTCASQCKATEKAPKYVDVHCRDATDSVAQLYKQQ------IRKGVNPDMSN 2032 Query: 367 ELITRIVADFV 399 + +T+ V F+ Sbjct: 2033 KSVTKTVKFFL 2043 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 504 ENVVKEAMRLYPVAPFL 554 E V+KE++RL+P P + Sbjct: 42 ELVIKESLRLFPPVPVI 58 >AY745213-1|AAU93480.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.0 bits (47), Expect = 7.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 486 RQRPIRENVVKEAMRLYPVA 545 +Q E V+KE+ RL PVA Sbjct: 99 KQMEYLERVIKESQRLCPVA 118 >AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CYP4C25 protein. Length = 149 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 504 ENVVKEAMRLYPVAPFL 554 E +KE +RLYP P + Sbjct: 62 EACIKEGLRLYPSVPLI 78 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 510 VVKEAMRLYPVAP 548 V+KE +RLYP P Sbjct: 64 VIKETLRLYPSVP 76 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 510 VVKEAMRLYPVAP 548 V+KE +RLYP P Sbjct: 64 VIKETLRLYPSVP 76 >AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CYP4H16 protein. Length = 151 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 510 VVKEAMRLYPVAPFL 554 V+KE++RL P PF+ Sbjct: 65 VIKESLRLVPPVPFV 79 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.0 bits (47), Expect = 7.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 156 SENSNNNISYSGVGFNSALFP*RTA 82 +EN N N S+S G L+P R A Sbjct: 618 NENENCNDSHSYCGLRDQLYPDRRA 642 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 7.4 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -1 Query: 422 AVVSPAAMTKSATILVINSSDIFSSFSLFTKPSPASFVCNI 300 A+ S + + S V++ D++ S T S A +C + Sbjct: 613 ALSSITSFSSSGNTTVVSDYDVYGKGSTSTTTSSAGTICTV 653 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.0 bits (47), Expect = 7.4 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -1 Query: 422 AVVSPAAMTKSATILVINSSDIFSSFSLFTKPSPASFVCNI 300 A+ S + + S V++ D++ S T S A +C + Sbjct: 614 ALSSITSFSSSGNTTVVSDYDVYGKGSTSTTTSSAGTICTV 654 >DQ004401-1|AAY21240.1| 153|Anopheles gambiae lysozyme c-7 protein. Length = 153 Score = 22.6 bits (46), Expect = 9.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 260 LMIPSLSLRKLYTKCCTQKTL 322 L +PSL K+YTKC K L Sbjct: 22 LGLPSLIDAKIYTKCELAKQL 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,221 Number of Sequences: 2352 Number of extensions: 11357 Number of successful extensions: 94 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -